GapMind for Amino acid biosynthesis

 

Aligments for a candidate for asd in Pseudomonas fluorescens GW456-L13

Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate PfGW456L13_3944 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)

Query= SwissProt::Q51344
         (370 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944
           Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)
          Length = 370

 Score =  685 bits (1768), Expect = 0.0
 Identities = 333/370 (90%), Positives = 357/370 (96%)

Query: 1   MKRVGLIGWRGMVGSVLMQRMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSI 60
           MKRVGLIGWRGMVGSVLMQRMLEE+DFDLIEPVFFTTSNVGGQGP VGKDIAPLKDAYSI
Sbjct: 1   MKRVGLIGWRGMVGSVLMQRMLEEQDFDLIEPVFFTTSNVGGQGPSVGKDIAPLKDAYSI 60

Query: 61  DELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKVID 120
           +ELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRM+DDAVIVLDPVNRKVID
Sbjct: 61  EELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMQDDAVIVLDPVNRKVID 120

Query: 121 QALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMG 180
           Q LDAGT+NYIGGNCTVSLMLM LGGLF+AGLVEWMSAMTYQAASGAGAQNMREL+KQMG
Sbjct: 121 QQLDAGTKNYIGGNCTVSLMLMGLGGLFEAGLVEWMSAMTYQAASGAGAQNMRELIKQMG 180

Query: 181 AAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQSR 240
           A HA+VAD LA+PASAILDIDR+VAE +RS+A+PTE+FG PL GSLIPWIDKELPNGQSR
Sbjct: 181 ATHAAVADQLADPASAILDIDRRVAEAMRSDAYPTENFGVPLAGSLIPWIDKELPNGQSR 240

Query: 241 EEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHN 300
           EEWKAQAETNKIL RFK+PIPVDGICVR+GAMRCHSQALTIKLNKDVP+ DIEGLISQHN
Sbjct: 241 EEWKAQAETNKILGRFKSPIPVDGICVRIGAMRCHSQALTIKLNKDVPIADIEGLISQHN 300

Query: 301 PWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPL 360
           PWVKLVPN+RE S++EL+P  VTGTL++PVGRLRKLNMGSQ++GAFTVGDQLLWGAAEPL
Sbjct: 301 PWVKLVPNNRETSIQELSPNKVTGTLNIPVGRLRKLNMGSQFVGAFTVGDQLLWGAAEPL 360

Query: 361 RRMLRILLER 370
           RRMLRILLER
Sbjct: 361 RRMLRILLER 370


Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 637
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 370
Length adjustment: 30
Effective length of query: 340
Effective length of database: 340
Effective search space:   115600
Effective search space used:   115600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate PfGW456L13_3944 (Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01745.hmm
# target sequence database:        /tmp/gapView.18317.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01745  [M=366]
Accession:   TIGR01745
Description: asd_gamma: aspartate-semialdehyde dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
   9.6e-199  645.7   0.0   1.1e-198  645.5   0.0    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944  Aspartate-semialdehyde dehydroge


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944  Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  645.5   0.0  1.1e-198  1.1e-198       1     366 []       2     368 ..       2     368 .. 0.99

  Alignments for each domain:
  == domain 1  score: 645.5 bits;  conditional E-value: 1.1e-198
                                               TIGR01745   1 kkvglvgwrgmvgsvllkrmqeekdfdaikpvffstsqlgqkapslakisailed 55 
                                                             k+vgl+gwrgmvgsvl++rm ee+dfd+i+pvff+ts++g+++ps++k  a+l+d
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944   2 KRVGLIGWRGMVGSVLMQRMLEEQDFDLIEPVFFTTSNVGGQGPSVGKDIAPLKD 56 
                                                             68***************************************************** PP

                                               TIGR01745  56 aydidalkeldiiitcqggdytkeiypklrkagwkgywidaasslrmkddaviil 110
                                                             ay i+ lk ld+i+tcqggdyt+e++pklr+agw+gywidaasslrm+ddavi+l
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944  57 AYSIEELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMQDDAVIVL 111
                                                             ******************************************************* PP

                                               TIGR01745 111 dpvnldvikdavnkgirtfvggnctvslllmslgglfrdelvewvsvatyqaasg 165
                                                             dpvn +vi++ ++ g+++++ggnctvsl+lm+lgglf+ +lvew+s++tyqaasg
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944 112 DPVNRKVIDQQLDAGTKNYIGGNCTVSLMLMGLGGLFEAGLVEWMSAMTYQAASG 166
                                                             ******************************************************* PP

                                               TIGR01745 166 ggarhmrellkqmgvlykeveeelakpssaileierkvtklsrseelpvenfsvp 220
                                                             +ga+ mrel+kqmg  +  v+++la p+sail+i+r+v++ +rs+  p+enf+vp
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944 167 AGAQNMRELIKQMGATHAAVADQLADPASAILDIDRRVAEAMRSDAYPTENFGVP 221
                                                             ******************************************************* PP

                                               TIGR01745 221 lagslipwidkqldngqsreewkgqaetnkilgt.kdtilvdglcvrigalrchs 274
                                                             lagslipwidk+l ngqsreewk qaetnkilg  k+ i+vdg+cvriga+rchs
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944 222 LAGSLIPWIDKELPNGQSREEWKAQAETNKILGRfKSPIPVDGICVRIGAMRCHS 276
                                                             ********************************964788***************** PP

                                               TIGR01745 275 qaltiklkkdvsleeieeiirahnkwvkvvpnereitlreltpaavtgtldipvg 329
                                                             qaltikl+kdv++ +ie +i +hn+wvk+vpn+re +++el+p  vtgtl+ipvg
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944 277 QALTIKLNKDVPIADIEGLISQHNPWVKLVPNNRETSIQELSPNKVTGTLNIPVG 331
                                                             ******************************************************* PP

                                               TIGR01745 330 rlrklnmgkeylsaftvgdqllwgaaeplrrmlrill 366
                                                             rlrklnmg +++ aftvgdqllwgaaeplrrmlrill
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3944 332 RLRKLNMGSQFVGAFTVGDQLLWGAAEPLRRMLRILL 368
                                                             ***********************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (366 nodes)
Target sequences:                          1  (370 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 10.20
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory