GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapC in Pseudomonas fluorescens GW456-L13

Align phosphoserine aminotransferase; EC 2.6.1.52 (characterized)
to candidate PfGW456L13_2175 Phosphoserine aminotransferase (EC 2.6.1.52)

Query= CharProtDB::CH_002572
         (362 letters)



>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175
           Phosphoserine aminotransferase (EC 2.6.1.52)
          Length = 363

 Score =  409 bits (1051), Expect = e-119
 Identities = 204/358 (56%), Positives = 254/358 (70%), Gaps = 2/358 (0%)

Query: 5   FNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVP 64
           +NF +GPA LP  VL++AQ EL DW+G G SVME+SHR  EF+ +A +AE+D RDLLN+P
Sbjct: 8   YNFCAGPAALPEAVLQRAQGELLDWHGKGLSVMEMSHRSDEFVSIATKAEQDLRDLLNIP 67

Query: 65  SNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVT 124
           SNYKVLF  GG   QFA +PLN+L +  +ADY+D G W+  AI+EA ++   NV      
Sbjct: 68  SNYKVLFLQGGASQQFAQIPLNLLPENGSADYIDTGIWSQKAIEEASRFGHVNVAATAKP 127

Query: 125 VDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPI 184
            D   A+    EW+LS +AAY+HY PNETI G+     P+ G DV + AD SS ILSRP+
Sbjct: 128 YDYF-AIPGQNEWKLSKDAAYVHYAPNETIGGLEFQWIPETG-DVPLVADMSSDILSRPV 185

Query: 185 DVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTF 244
           DVSR+G+IYAGAQKNIGP+G+ + IVREDLLGKA   CP++LDY +  DNGSM+NTPPT 
Sbjct: 186 DVSRFGMIYAGAQKNIGPSGIVVNIVREDLLGKARSLCPTMLDYKVAADNGSMYNTPPTL 245

Query: 245 AWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNVPFQL 304
           AWYLSGLVF+WLK  GGV  + K+N+ K   LY  ID S  Y N + K++RS MNVPF+L
Sbjct: 246 AWYLSGLVFEWLKEQGGVEAIGKLNEVKQRTLYSFIDASGLYSNPINKSDRSWMNVPFRL 305

Query: 305 ADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRHG 362
           AD  LDK FL  +   GL  LKGHR VGGMRASIYNA+ +  V AL  +M EFE+ HG
Sbjct: 306 ADDRLDKPFLAGADERGLLNLKGHRSVGGMRASIYNAVDINAVNALISYMAEFEKEHG 363


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 418
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 363
Length adjustment: 29
Effective length of query: 333
Effective length of database: 334
Effective search space:   111222
Effective search space used:   111222
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate PfGW456L13_2175 (Phosphoserine aminotransferase (EC 2.6.1.52))
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01364.hmm
# target sequence database:        /tmp/gapView.6979.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01364  [M=358]
Accession:   TIGR01364
Description: serC_1: phosphoserine transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
   3.2e-164  532.0   0.0   3.6e-164  531.8   0.0    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175  Phosphoserine aminotransferase (


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175  Phosphoserine aminotransferase (EC 2.6.1.52)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  531.8   0.0  3.6e-164  3.6e-164       2     358 .]       8     362 ..       7     362 .. 0.99

  Alignments for each domain:
  == domain 1  score: 531.8 bits;  conditional E-value: 3.6e-164
                                               TIGR01364   2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlre 56 
                                                             +nF+aGPaalpe+vl++aq elld++g+glsvme+sHRs+ef +++++ae+dlr+
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175   8 YNFCAGPAALPEAVLQRAQGELLDWHGKGLSVMEMSHRSDEFVSIATKAEQDLRD 62 
                                                             8****************************************************** PP

                                               TIGR01364  57 LlnipdnyevlflqGGattqfaavplnllkekkvadyivtGawskkalkeakklt 111
                                                             Llnip+ny+vlflqGGa++qfa++plnll e+  adyi tG ws+ka++ea++++
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175  63 LLNIPSNYKVLFLQGGASQQFAQIPLNLLPENGSADYIDTGIWSQKAIEEASRFG 117
                                                             ******************************************************9 PP

                                               TIGR01364 112 kevkvvaseeekkyskipdeeelelkedaayvylcanetieGvefkelpevkkap 166
                                                             + v+v+a+++  +y +ip ++e++l++daayv+++ neti G+ef+++pe+ ++p
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175 118 H-VNVAATAKPYDYFAIPGQNEWKLSKDAAYVHYAPNETIGGLEFQWIPETGDVP 171
                                                             9.***************************************************** PP

                                               TIGR01364 167 lvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivrkdllerakkelpsv 221
                                                             lvaD+ssdilsr++dvs++g+iyaGaqKniGp+G++v ivr+dll++a++ +p++
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175 172 LVADMSSDILSRPVDVSRFGMIYAGAQKNIGPSGIVVNIVREDLLGKARSLCPTM 226
                                                             ******************************************************* PP

                                               TIGR01364 222 ldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYeai 276
                                                             ldYk++a+n s+yntppt a+y++glv++wlke+GGv+++ k n+ K + lY  i
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175 227 LDYKVAADNGSMYNTPPTLAWYLSGLVFEWLKEQGGVEAIGKLNEVKQRTLYSFI 281
                                                             ******************************************************* PP

                                               TIGR01364 277 desegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGi 331
                                                             d+s g+y n+++k++Rs+mnv+F+l++++l+k Fl+ a e+gl++lkGhrsvGG+
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175 282 DAS-GLYSNPINKSDRSWMNVPFRLADDRLDKPFLAGADERGLLNLKGHRSVGGM 335
                                                             *99.6************************************************** PP

                                               TIGR01364 332 RasiYnalpleevqaLvdfmkeFekkh 358
                                                             RasiYna+ +++v+aL+++m eFek+h
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2175 336 RASIYNAVDINAVNALISYMAEFEKEH 362
                                                             ************************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (358 nodes)
Target sequences:                          1  (363 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 10.53
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory