Align Probable methanogen homoaconitase large subunit; HACN; EC 4.2.1.114; Homoaconitate hydratase (uncharacterized)
to candidate PfGW456L13_3948 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)
Query= curated2:O27668 (428 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3948 Length = 472 Score = 196 bits (499), Expect = 1e-54 Identities = 140/442 (31%), Positives = 207/442 (46%), Gaps = 62/442 (14%) Query: 30 VDLAMTHDGTSPPTIRTFRDIASRGGPARVWDPERIVMVFDHNVPANTIGAAEFQRVTRE 89 +D + H+ TSP R +A R + W + + DHNVP + + Sbjct: 28 IDRHIIHEVTSPQAFEGLR-LAGR----KPWRIDANIATPDHNVPTTPERKGGIDAIVDQ 82 Query: 90 FAR-----------EQGIVNIFQNAA--GICHQVLPERGFVRPGMVIVGADSHTCTYGAF 136 +R E GIV N GI H + PE+G PGM +V DSHT T+GAF Sbjct: 83 VSRLQVQTLDDNCDEYGIVEFKMNDVRQGIVHVIGPEQGATLPGMTVVCGDSHTSTHGAF 142 Query: 137 GAFATGMGATDMAMVFATGKTWFMVPEAMRIEVTGEPEGHVYAKDVILHIIGEIGVDGAT 196 GA A G+G +++ V AT + M + V G+ V AKD++L +IG+IG G Sbjct: 143 GALAHGIGTSEVEHVLATQCLVAKKMKNMLVRVEGQLPFGVTAKDIVLAVIGKIGTAGGN 202 Query: 197 YRSVEFTGDTIESMDVSGRMTICNMAVEMGAKNGIMEPNRQTLDYVRAR----TGRE--- 249 ++EF G I + V GRMTICNM++E GA+ G++ + +T+ YV+ R G E Sbjct: 203 GHAIEFAGSAIRDLSVEGRMTICNMSIEAGARVGLVAADEKTVAYVKGRPFAPKGAEWDL 262 Query: 250 ----FRVYSSDEDSQYLEDHHFDVSDLEPQVA--------------CPDDVDNVYPVHR- 290 ++ SD D+ + D + ++PQV+ PD + V R Sbjct: 263 AVEAWKDLVSDADATFDTVVELDATQIKPQVSWGTSPEMVLAVDQNVPDPAKEMDLVKRD 322 Query: 291 ----------------VEGTHIDEAFLGSCTNGRYEDLKIAAEVIGDRRVHEDVR-FIVS 333 + +D F+GSCTN R EDL+ AA + R+V ++ IV Sbjct: 323 SIVRALKYMGLTANQAITDIQLDRVFIGSCTNSRIEDLRAAAVIAKGRKVASTIKQAIVV 382 Query: 334 PASREIYLKALEDGIIETFIRAGAIVCNPGCGPCLGAHMGVLAPGEVSIATTNRNFRGRM 393 P S + +A +G+ + F+ AG PGC CL + L GE +T+NRNF GR Sbjct: 383 PGSGLVKAQAESEGLDKIFLEAGFEWREPGCSMCLAMNPDRLESGEHCASTSNRNFEGRQ 442 Query: 394 GDPASSVYLANPAVVAESAIEG 415 G +L +PA+ A +AI G Sbjct: 443 G-AGGRTHLVSPAMAAAAAING 463 Lambda K H 0.320 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 472 Length adjustment: 33 Effective length of query: 395 Effective length of database: 439 Effective search space: 173405 Effective search space used: 173405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory