Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate PfGW456L13_1007 Homoserine O-acetyltransferase (EC 2.3.1.31)
Query= SwissProt::F7XKY8 (492 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 Length = 379 Score = 381 bits (978), Expect = e-110 Identities = 189/372 (50%), Positives = 261/372 (70%), Gaps = 6/372 (1%) Query: 5 SLGIVETKYYHLEEELKLESGRKISDVTIAYEAYGTLNRDKNNVILVCHALTGDAHAAGW 64 S+G+V + H E L L GR + + YE YGTLN +N +L+CHAL+G HAAG+ Sbjct: 9 SVGLVTPQVAHFSEPLALACGRSLPAYDLIYETYGTLNATASNAVLICHALSGHHHAAGY 68 Query: 65 HKGDN-KPGWWDILIGPGKCLDTDKYFIVCSNVIGGCRGSTGPSSIDPETGKPYGLSFPV 123 H D+ KPGWWD IGPGK +DT K+F+V N +GGC GSTGPSSI+P+TGKP+G FPV Sbjct: 69 HSADDRKPGWWDSCIGPGKPIDTSKFFVVSLNNLGGCNGSTGPSSINPDTGKPFGADFPV 128 Query: 124 ITIKDMVNAQKKLLDHLGISSIYAVIGGSMGGLQVLQWSVSYPDYINKAIALAASAYSSP 183 +T++D V++Q +L D LGI+ AVIGGS+GG+Q +QWS++YPD I +A+A++ S Sbjct: 129 LTVEDWVHSQARLADRLGIAQFAAVIGGSLGGMQAMQWSITYPDRIRHCLAIASAPKLSA 188 Query: 184 QQIAFNEVARIAIISDPEWNKGNYY-YSRQPSHGLALARMIGHITYLSDESMREKFGREL 242 Q IAFNEVAR AI++DPE++ G++ ++ P GL LARM+GHITYLSD+SM EKFGR L Sbjct: 189 QNIAFNEVARQAILTDPEFHGGSFQEHNVIPKRGLMLARMVGHITYLSDDSMGEKFGRGL 248 Query: 243 QDRDRYNYDL-SMDFQVESYLHYKGRSFTERFDANSYLYITKAVDYFDLTEN--GSLIDG 299 + ++ NYD S++FQVESYL Y+G F+ RFDAN+YL +TKA+DYFD N +L Sbjct: 249 KS-EKLNYDFHSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAANFDDNLAKT 307 Query: 300 LKDIKAKCLIIAVTSDWLYPPYQSKDIVMALNANNVDVTYREIESNYGHDAFLLEAGQLN 359 + KAK +++ T+DW + P +S+++V AL A DV Y EI++ GHDAFL+ + Sbjct: 308 FEGAKAKFCVMSFTTDWRFSPARSRELVDALMAARKDVCYLEIDAPQGHDAFLIPIPRYL 367 Query: 360 YVIGGFLNNITV 371 G ++N IT+ Sbjct: 368 QAFGNYMNRITL 379 Lambda K H 0.318 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 379 Length adjustment: 32 Effective length of query: 460 Effective length of database: 347 Effective search space: 159620 Effective search space used: 159620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate PfGW456L13_1007 (Homoserine O-acetyltransferase (EC 2.3.1.31))
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.3466.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-142 458.1 0.0 1.1e-141 457.9 0.0 1.0 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 Homoserine O-acetyltransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 Homoserine O-acetyltransferase (EC 2.3.1.31) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.9 0.0 1.1e-141 1.1e-141 3 345 .. 22 369 .. 20 375 .. 0.97 Alignments for each domain: == domain 1 score: 457.9 bits; conditional E-value: 1.1e-141 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.. 55 e+l l +G l+ +++ y+tyGtlna +Navl+cHal+g++h+ag+++++d+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 22 EPLALACGRSLPAYDLIYETYGTLNATASNAVLICHALSGHHHAAGYHSADDRkp 76 789********************************************99888789 PP TIGR01392 56 GWWdellGpgraldtsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvti 110 GWWd+ +Gpg+++dts++fvv+lN+lG+c+GstgP+sinp+tgkp+ga+fP++t+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 77 GWWDSCIGPGKPIDTSKFFVVSLNNLGGCNGSTGPSSINPDTGKPFGADFPVLTV 131 ******************************************************* PP TIGR01392 111 rDlvkaqkalldsLgveklaavvGgSlGGmqalewalsypervkkivvlatsara 165 +D+v+ q++l+d+Lg+ ++aav+GgSlGGmqa++w+++yp+r+++++++a+++++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 132 EDWVHSQARLADRLGIAQFAAVIGGSLGGMQAMQWSITYPDRIRHCLAIASAPKL 186 ******************************************************* PP TIGR01392 166 saqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARmlalltYrseesle 219 saq+iafnev+rqail+Dpe+++G+++e++ P++GL lARm++++tY+s++s+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 187 SAQNIAFNEVARQAILTDPEFHGGSFQEHNvIPKRGLMLARMVGHITYLSDDSMG 241 ******************************9************************ PP TIGR01392 220 erfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdl 274 e+fgr kse+ ++ ef+vesylryqg++f rFdAn+Yll+tkald++d lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 242 EKFGRGLKSEKLNYDFHSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDP 296 ********9977777779************************************* PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeie 327 a++ +d+l+++++ +ka+++v+++++D++f++++++el++al aa+++ y ei+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 297 AANFDDNLAKTFEGAKAKFCVMSFTTDWRFSPARSRELVDALMAARKDvcYLEID 351 ********************************************999999***** PP TIGR01392 328 seeGHDaFllekekveel 345 ++GHDaFl+ ++ ++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1007 352 APQGHDAFLIPIPRYLQA 369 *********988776665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.87 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory