Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate PfGW456L13_2176 Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51)
Query= SwissProt::P27603 (365 letters) >lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2176 Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51) Length = 364 Score = 632 bits (1630), Expect = 0.0 Identities = 317/365 (86%), Positives = 341/365 (93%), Gaps = 1/365 (0%) Query: 1 MSEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWV 60 MSE +LKALR+RID+LDE++L+LISERARCAQEVARVK AS + E VFYRPEREA V Sbjct: 1 MSE-QELKALRLRIDALDEKVLELISERARCAQEVARVKMASLAEGEVPVFYRPEREAQV 59 Query: 61 LKHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVI 120 LK +ME N+GPL NEEMARLFREIMSSCLALEQPL+VAYLGPEGTF+QAAA+KHFGH+VI Sbjct: 60 LKRVMERNQGPLGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVI 119 Query: 121 SKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL 180 SKPMAAIDEVFREV AGAVNFGVVPVENSTEGAVNHTLDSFLEHD+VICGEVELRIHHHL Sbjct: 120 SKPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHL 179 Query: 181 LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA 240 LVGE TKTD I+RIYSHAQSLAQCRKWLDAHYPNVERVAVSSNA+AAKRVK EWNSAAIA Sbjct: 180 LVGENTKTDSISRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIA 239 Query: 241 GDMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL 300 GDMAA LYGL++LAEKIEDRP NSTRFL+IG+QEVPPTGDDKTSIIVSM NKPGALHELL Sbjct: 240 GDMAAGLYGLTRLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSNKPGALHELL 299 Query: 301 MPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSY 360 +PFH NGIDLTRIETRPSRSGKWTYVFFID +GHH+DPL+K VLEKI EAVALKVLGSY Sbjct: 300 VPFHDNGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSY 359 Query: 361 PKAVL 365 PKAVL Sbjct: 360 PKAVL 364 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 504 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 364 Length adjustment: 29 Effective length of query: 336 Effective length of database: 335 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate PfGW456L13_2176 (Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51))
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01807.hmm # target sequence database: /tmp/gapView.10851.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01807 [M=76] Accession: TIGR01807 Description: CM_P2: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-34 104.0 2.8 2.1e-34 103.9 1.3 1.9 2 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2176 Chorismate mutase I (EC 5.4.99.5 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2176 Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (E # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.9 1.3 2.1e-34 2.1e-34 1 76 [] 6 84 .. 6 84 .. 0.93 2 ? -3.0 0.0 0.51 0.51 67 75 .. 125 133 .. 122 134 .. 0.80 Alignments for each domain: == domain 1 score: 103.9 bits; conditional E-value: 2.1e-34 TIGR01807 1 LkelRnkiDaiDdrildLlseRaklakavgelKkks...aseaviYRPeREaavlrr 54 Lk+lR +iDa+D+++l+L+seRa++a++v+++K +s + v+YRPeREa+vl+r lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2176 6 LKALRLRIDALDEKVLELISERARCAQEVARVKMASlaeGEVPVFYRPEREAQVLKR 62 799********************************9633333579************ PP TIGR01807 55 lkelnkGpLdqeavarifrEim 76 ++e+n+GpL +e++ar+frEim lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2176 63 VMERNQGPLGNEEMARLFREIM 84 *********************9 PP == domain 2 score: -3.0 bits; conditional E-value: 0.51 TIGR01807 67 avarifrEi 75 a++ +frE+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2176 125 AIDEVFREV 133 789999998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (76 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.63 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory