Align chorismate mutase (EC 5.4.99.5) (characterized)
to candidate PfGW456L13_2709 Periplasmic chorismate mutase I precursor (EC 5.4.99.5)
Query= BRENDA::B2JYH9 (182 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2709 Length = 190 Score = 115 bits (288), Expect = 5e-31 Identities = 66/161 (40%), Positives = 94/161 (58%), Gaps = 8/161 (4%) Query: 22 DAFVPLVRSMADRLNTADQVALSKWDTGQPVYDGQREAQVIANAATMASEYGLTAEDAIN 81 DA PL+ +M +RLN ++ VAL+KWD+G+PV D REAQVIANA A+E L +D Sbjct: 33 DALQPLLATMNERLNISELVALTKWDSGKPVQDNTREAQVIANARKQAAERQLDPDDVAV 92 Query: 82 IFSDQVEANKEVQYALLNNWRRQGDAPATPRQSLAGVIRPILDKLQASIMQNLQSVAPLR 141 + + Q+EA+K VQY L W+ AP TPR L IRP LD LQ ++ + P R Sbjct: 93 LIAAQIEASKLVQYGRLAQWQAAHKAPDTPRPDLGNDIRPKLDNLQNLLLTQYAAFLPYR 152 Query: 142 SIADCHALVASAVGQVAEQASL--DVLHRAALDRAVARICV 180 + +C +A+ E+++L D LH A+ RA +C+ Sbjct: 153 NDPNCPQWLAT------ERSALIKDYLHGQAMIRATGELCI 187 Lambda K H 0.318 0.129 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 77 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 182 Length of database: 190 Length adjustment: 20 Effective length of query: 162 Effective length of database: 170 Effective search space: 27540 Effective search space used: 27540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
Align candidate PfGW456L13_2709 (Periplasmic chorismate mutase I precursor (EC 5.4.99.5))
to HMM TIGR01806 (putative chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01806.hmm # target sequence database: /tmp/gapView.16321.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01806 [M=114] Accession: TIGR01806 Description: CM_mono2: putative chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-35 107.8 1.2 2.2e-35 107.5 1.2 1.1 1 lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2709 Periplasmic chorismate mutase I Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2709 Periplasmic chorismate mutase I precursor (EC 5.4.99.5) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.5 1.2 2.2e-35 2.2e-35 4 114 .] 33 145 .. 30 145 .. 0.97 Alignments for each domain: == domain 1 score: 107.5 bits; conditional E-value: 2.2e-35 TIGR01806 4 aaldqlvdlaneRleladaValyKaesnlpieDsereeqvLdslraqaksaglde 58 al+ l+ +neRl++++ Val K++s++p++D+ re+qv++++r+qa + ld+ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2709 33 DALQPLLATMNERLNISELVALTKWDSGKPVQDNTREAQVIANARKQAAERQLDP 87 5789999************************************************ PP TIGR01806 59 dsverlfqaqinAnkaiqyrllsdWk.skaeppvevrdLe.dlRakidqlntelL 111 d+v+ l++aqi+A+k++qy +l++W+ +++p ++++dL d+R+k+d+l++ lL lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2709 88 DDVAVLIAAQIEASKLVQYGRLAQWQaAHKAPDTPRPDLGnDIRPKLDNLQNLLL 142 **************************999999*******99************** PP TIGR01806 112 eal 114 +++ lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2709 143 TQY 145 986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (114 nodes) Target sequences: 1 (190 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.24 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory