Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate PfGW456L13_1971 Succinylornithine transaminase (EC 2.6.1.81)
Query= curated2:Q5HJI8 (394 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1971 Length = 406 Score = 249 bits (637), Expect = 8e-71 Identities = 140/373 (37%), Positives = 210/373 (56%), Gaps = 9/373 (2%) Query: 15 NYAPLKLVISKGKGVKVWDTDGKQYIDCISGFSVANQGHCHPTIVKAMTEQASKLSIISR 74 NYAP + +G G +VWD G++ ID G +V GH HP +V A+TEQA+KL +S Sbjct: 20 NYAPAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVGALTEQANKLWHVSN 79 Query: 75 VLYSDNLGKWEEKICHLAKKDKVLPLNSGTEAVEAAIKIARKWGSEVKGITDGQVEIIAM 134 V ++ + K+ ++ NSG EA EAA K+AR+ + G + EIIA Sbjct: 80 VFTNEPALRLAHKLVDATFAERAFFCNSGAEANEAAFKLARRVAFDRYG--SEKYEIIAA 137 Query: 135 NNNFHGRTLGSLSLSNHDAYKAGFHPLLQGTTTVDFGDIEQLTQAISPNTAAIILEPIQG 194 N+FHGRTL ++++ Y GF P + G T V + D+ L A+S T A++LEPIQG Sbjct: 138 LNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVPYNDLAALKAAVSDKTCAVVLEPIQG 197 Query: 195 EGGVNIPPKGYIQAVRQLCDKHQILLIADEIQVGLGRTGKWFAMEWEQVVPDIYILGKAL 254 EGGV Y+Q R+LC++H LL+ DE+Q G+GRTG FA + V+PDI K+L Sbjct: 198 EGGVLPAELAYLQGARELCNEHNALLVFDEVQTGMGRTGHLFAYQHYGVIPDILTSAKSL 257 Query: 255 GGGLYPVSAVLANNDVMRVLTPGTHGSTFGGNPLAIAISTAALDVLKDEQLVERSERLGS 314 GGG +P++A+L D+ + L GTHG+T+GGNPLA A++ A +DV+ +++ Sbjct: 258 GGG-FPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVAGAVIDVINTPEVLAGVNAKHD 316 Query: 315 FLLKALLQL--KHPSIKEIRGRGLFIGIELNT----DAAPFVDQLIQRGILCKDTHRTII 368 L Q+ K+ ++RG GL IG L+ A + Q G++ ++ Sbjct: 317 KFKARLEQIGEKYGLFTQVRGLGLLIGCVLSDAWKGKAKDIFNAAEQEGLMILQAGPDVV 376 Query: 369 RLSPPLVIDKEEI 381 R +P LV++ +I Sbjct: 377 RFAPSLVVEDADI 389 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 406 Length adjustment: 31 Effective length of query: 363 Effective length of database: 375 Effective search space: 136125 Effective search space used: 136125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory