Align Acetylornithine aminotransferase; Short=ACOAT; EC 2.6.1.11 (characterized, see rationale)
to candidate PfGW456L13_4910 Acetylornithine aminotransferase (EC 2.6.1.11)
Query= uniprot:A0A806JQF3 (400 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4910 Length = 413 Score = 317 bits (812), Expect = 4e-91 Identities = 176/389 (45%), Positives = 237/389 (60%), Gaps = 14/389 (3%) Query: 17 AVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGHRHPAVIEAVTRQMSTL 76 A +M+ Y ++ G G + D GR Y+D + G+AV +GH HP ++ A+T Q L Sbjct: 26 ACLMSTYQPLALSFNKGLGTRLWDQAGREYLDAVAGVAVTNVGHSHPKIVAAITEQAGLL 85 Query: 77 GHTSNLYATEPGIALAEELVALLGADQRTRVFFCNSGAEANEAAFKLSRLTGRTK----- 131 HTSNLY+ + LA++L L G D R FF NSGAEANE A K++RL G K Sbjct: 86 LHTSNLYSIDWQQRLAQKLTQLAGMD---RAFFNNSGAEANETALKIARLHGWHKGIEQP 142 Query: 132 -LVAAHDAFHGRTMGSLALTGQPAKQTPFAPLPGDVTHVGYGDVDAL---AAAVDDHTAA 187 +V +AFHGRT+G+L+ + PA + F LPGD V +GD+ AL A A Sbjct: 143 LVVVMENAFHGRTLGTLSASDGPAVRLGFNKLPGDFVKVPFGDLGALDKVQQAFGSRIVA 202 Query: 188 VFLEPIMGESGVVVPPAGYLAAARDITARRGALLVLDEVQTGMGRTGAFFAHQHDGITPD 247 V +EPI GESGV + P GYL+A R++ RR LL+LDE+QTG+GRTG +FA QH+GI PD Sbjct: 203 VLMEPIQGESGVQLAPPGYLSAVRELCNRRSWLLMLDEIQTGIGRTGQWFAFQHEGIVPD 262 Query: 248 VVTLAKGLGGGLPIGACLAVGPAAELLTPGLHGSTFGGNPVCAAAALAVLRVLASDGLVR 307 V+TLAKGLG G+PIGACLA G AAEL TPG HGSTFGGNP+ VL ++ GL+ Sbjct: 263 VMTLAKGLGNGVPIGACLARGKAAELFTPGSHGSTFGGNPLACRVGCTVLDIVEEQGLLE 322 Query: 308 RAEVLGKSL--RHGIEALGHPLIDHVRGRGLLLGIALTAPHAKDAEATARDAGYLVNAAA 365 A + G L R E G+P + +RG+GL++GI L P + ARD G L+N Sbjct: 323 NARLQGARLLERLRTELAGNPNVSQIRGQGLMIGIELKQPIRDLSLIAARDHGLLINVTR 382 Query: 366 PDVIRLAPPLIIAEAQLDGFVAALPAILD 394 + IRL PPL + E +++ V + +++ Sbjct: 383 GNTIRLLPPLTLDEREVEMIVRGVGRVVN 411 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 413 Length adjustment: 31 Effective length of query: 369 Effective length of database: 382 Effective search space: 140958 Effective search space used: 140958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory