Align Gamma-glutamyl phosphate reductase; GPR; EC 1.2.1.41; Glutamate-5-semialdehyde dehydrogenase; Glutamyl-gamma-semialdehyde dehydrogenase; GSA dehydrogenase (uncharacterized)
to candidate PfGW456L13_3571 Gamma-glutamyl phosphate reductase (EC 1.2.1.41)
Query= curated2:B6JD19 (428 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3571 Length = 500 Score = 124 bits (312), Expect = 5e-33 Identities = 115/389 (29%), Positives = 179/389 (46%), Gaps = 50/389 (12%) Query: 58 AANAEDVAEARASGATPAFVDRLALNDARIETMAAGLDVVRGLDDPVGKVTERWTRPNGM 117 AAN D+ A+A G + RL ++ M AGL R GKV +G Sbjct: 102 AANLADIERAKARGRSTT---RLLADERMRRDMIAGLRAWRDAPASRGKVISS-VEHDGW 157 Query: 118 TIERVRVPLGVAAVIFESRPNVLADAGALCLKSGNAVILRGGSDSFRSCQAI--HACLTQ 175 +E+V PLG+ A +FE RPNV ADA + L++GN +LR GSD+ + QAI HA L Sbjct: 158 KVEQVVSPLGIVAFVFEGRPNVFADAAGV-LRTGNTAVLRIGSDALGTAQAIVTHA-LNP 215 Query: 176 GLREAGLPEAAISLVPTRDRAAVGLLLSGLDGRIDVIVPRGGKSLVAR---VEAEARVPV 232 L +AGLP A+SLV + + AA + + D R+ + V RG V++ + +A V Sbjct: 216 ALSDAGLPAGAVSLVESVNHAAGWAMFA--DRRLSLAVARGSGRAVSQLGSIAQQAGTAV 273 Query: 233 FAHLDGNNHVFVDKAASLDMAKTIVLNAKMRRPGICGAAETLLVDKAAAPAQLKPL---- 288 H G + + A +V N+ R+ +C L+ + A A+L PL Sbjct: 274 SLHGTGGAWLIANADADAPRFAAVVRNSLDRK--VCNTLNVCLIHRDRA-AELVPLFLDA 330 Query: 289 ---VGMLIDAGCE---VRGD-----------------TDVQKADARVTPVTEDDWATEF- 324 G GC+ V G + +++A+ P+ ED E+ Sbjct: 331 LKQAGTARGQGCKLHIVEGSESHLPQDWLAATVQVYRAEGYQSEAQAEPLPEDQLGREWE 390 Query: 325 --EAPIIAAKVVGGLDEAIAHIERYGSHHTDAIVTDDATAATRFLNEVDSAIVLHNASTQ 382 E P ++ K+V LD+ I RY T +++++ A A RF N V++ V N T+ Sbjct: 391 WEETPEVSLKIVDNLDDGITLFNRYSPQFTVSLISESAEAQERFYNAVNAPFV-GNGITR 449 Query: 383 FADGGEFGFGAEIGIA---TGKFHARGPV 408 + DG E+G++ +G+ AR + Sbjct: 450 WVDGQYALNKPELGLSNWESGRLFARSAI 478 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 500 Length adjustment: 33 Effective length of query: 395 Effective length of database: 467 Effective search space: 184465 Effective search space used: 184465 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory