GapMind for Amino acid biosynthesis


Aligments for a candidate for serB in Pseudomonas fluorescens GW456-L13

Align Phosphoserine phosphatase; PSP; PSPase; EC (characterized)
to candidate PfGW456L13_4124 Homoserine kinase (EC

Query= SwissProt::Q883R9
         (237 letters)

>lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4124 Homoserine
           kinase (EC
          Length = 205

 Score =  380 bits (977), Expect = e-111
 Identities = 188/205 (91%), Positives = 197/205 (96%)





Lambda     K      H
   0.324    0.139    0.410 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 253
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 237
Length of database: 205
Length adjustment: 22
Effective length of query: 215
Effective length of database: 183
Effective search space:    39345
Effective search space used:    39345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)

Align candidate PfGW456L13_4124 (Homoserine kinase (EC
to HMM TIGR02137 (thrH: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR02137.hmm
# target sequence database:        /tmp/gapView.18502.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02137  [M=203]
Accession:   TIGR02137
Description: HSK-PSP: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                               -----------
   7.2e-120  383.9   0.1   8.3e-120  383.7   0.1    1.0  1  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4124  Homoserine kinase (EC

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4124  Homoserine kinase (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  383.7   0.1  8.3e-120  8.3e-120       2     203 .]       2     203 ..       1     203 [. 0.99

  Alignments for each domain:
  == domain 1  score: 383.7 bits;  conditional E-value: 8.3e-120
                                               TIGR02137   2 evvtldlegvlvpeiwiavaektgiddlklttrdipdydvlmkqrlkileeenlk 56 
                                                             79***************************************************** PP

                                               TIGR02137  57 lsdiqeviatlkllegavefvdtlreeaqvvilsdtfqefaqplmkqlgfptllc 111
                                                             lsdiqeviatlk+l+ga efvd+lre++qvvilsdtf+ef+qplm+qlgfptllc
                                                             ******************************************************* PP

                                               TIGR02137 112 hklvvedsdrvkgyqlrqkdqkrkvvkalkelyykviaagdsyndttmlkeadkg 166
                                                             h+l  +d+ rv  yqlrqkd+kr++v a+k+lyy+viaagdsyndttml ead+g
                                                             ******************************************************* PP

                                               TIGR02137 167 ilfhapesvvaefpqleavktyeelkdkflkasdrsl 203
                                                             ilfhap++v+a+fpq++av+t+e lk++f kas+r+l
  lcl|FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4124 167 ILFHAPDNVIAQFPQFPAVHTFEALKQEFIKASNRTL 203
                                                             **********************************986 PP

Internal pipeline statistics summary:
Query model(s):                            1  (203 nodes)
Target sequences:                          1  (205 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 6.72

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory