GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argG in Pseudomonas fluorescens FW300-N1B4

Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate Pf1N1B4_742 Argininosuccinate synthase (EC 6.3.4.5)

Query= SwissProt::P59846
         (400 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742 Argininosuccinate
           synthase (EC 6.3.4.5)
          Length = 405

 Score =  503 bits (1296), Expect = e-147
 Identities = 249/393 (63%), Positives = 301/393 (76%), Gaps = 3/393 (0%)

Query: 2   KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61
           K+VLAYSGGLDTS+ILKWL++TY  EV+ FTAD+GQGEEVE AR KA   G  +    DL
Sbjct: 6   KVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQGEEVEPARAKAQAMGVKEIYIDDL 65

Query: 62  KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121
           +EEFVRDFVFPM RA  VYEG YLLGTSIARPLIAK L+ IA E GA+AI+HGATGKGND
Sbjct: 66  REEFVRDFVFPMFRANTVYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGATGKGND 125

Query: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEK--PYSMDANLL 179
           QVRFEL AYALKP +KVIAPWREW    R++++ YAE H IP+    +K  PYSMDANLL
Sbjct: 126 QVRFELGAYALKPGVKVIAPWREWDLLSREKLMDYAEKHNIPIERHGKKKSPYSMDANLL 185

Query: 180 HISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL 239
           HISYEGGVLED W E  + M+R T  PE+APD  +Y+E+ +  GD VA++G  ++PA +L
Sbjct: 186 HISYEGGVLEDTWTEHEEDMWRWTVSPEKAPDKAQYLELTYRNGDIVALDGVEMTPATVL 245

Query: 240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRD 299
             LN IGG HG+GR+DIVENR+VGMKSRG YETPGGTI+  A RA+ES+TLDREV H +D
Sbjct: 246 ATLNRIGGEHGIGRLDIVENRYVGMKSRGCYETPGGTIMLRAHRAIESITLDREVAHLKD 305

Query: 300 MLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYR 359
            L PKYA L+Y G+W++PER  LQ   D     V GV RLKLYKGNV V GRK+ +SL+ 
Sbjct: 306 ELMPKYASLIYTGYWWSPERLMLQQMIDASQAHVNGVVRLKLYKGNVIVTGRKSDESLFD 365

Query: 360 QDLVSFDEAGG-YDQKDAEGFIKIQALRLRVRA 391
            ++ +F+E GG Y+Q DA GFIK+ ALR+R+ A
Sbjct: 366 ANIATFEEDGGAYNQADAAGFIKLNALRMRIAA 398


Lambda     K      H
   0.319    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 503
Number of extensions: 19
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 405
Length adjustment: 31
Effective length of query: 369
Effective length of database: 374
Effective search space:   138006
Effective search space used:   138006
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate Pf1N1B4_742 (Argininosuccinate synthase (EC 6.3.4.5))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00032.hmm
# target sequence database:        /tmp/gapView.4337.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00032  [M=394]
Accession:   TIGR00032
Description: argG: argininosuccinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   5.4e-146  472.8   0.0   6.2e-146  472.6   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742  Argininosuccinate synthase (EC 6


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742  Argininosuccinate synthase (EC 6.3.4.5)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  472.6   0.0  6.2e-146  6.2e-146       1     391 [.       6     399 ..       6     402 .. 0.97

  Alignments for each domain:
  == domain 1  score: 472.6 bits;  conditional E-value: 6.2e-146
                                     TIGR00032   1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDareef 64 
                                                   kvvlaysGGlDtsv+lk+l++  ++ev+++t+d+Gq+ e+++ ++ ka ++G+++ y+ D reef
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742   6 KVVLAYSGGLDTSVILKWLQDTyNCEVVTFTADLGQG-EEVEPARAKAQAMGVKEIYIDDLREEF 69 
                                                   8*********************99************9.9************************** PP

                                     TIGR00032  65 vkdylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsil 129
                                                   v+d++f+  +an+vyeg+Yll+t++aRpliak+l+e+a++ ga+a++hG+tgKGnDqvRFel  +
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742  70 VRDFVFPMFRANTVYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGATGKGNDQVRFELGAY 134
                                                   ***************************************************************** PP

                                     TIGR00032 130 llnpdlkviaPvreleli.ReeeieyaaekGievpv..ekekaysiDenllgrsiEageLEdpst 191
                                                   +l+p +kviaP+re++l  Re++++ya+++ i+++   +k+++ys+D nll++s+E+g LEd +t
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742 135 ALKPGVKVIAPWREWDLLsREKLMDYAEKHNIPIERhgKKKSPYSMDANLLHISYEGGVLEDTWT 199
                                                   ****************987************999862267889********************** PP

                                     TIGR00032 192 eppediyelvkdpiektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDiv 256
                                                   e  ed+++++++p++++ d+++++e+++++G  val+g++++p +++ ++n+i+g+hG+Gr+Div
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742 200 EHEEDMWRWTVSPEKAP-DKAQYLELTYRNGDIVALDGVEMTPATVLATLNRIGGEHGIGRLDIV 263
                                                   ***********998887.*********************************************** PP

                                     TIGR00032 257 EdRiiglKsReiYEapalllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaeal 321
                                                   E+R++g+KsR++YE+p+ +++++Ah+++e+ +l+++v+++k+    ky+ liY+G+w++p++ +l
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742 264 ENRYVGMKSRGCYETPGGTIMLRAHRAIESITLDREVAHLKDELMPKYASLIYTGYWWSPERLML 328
                                                   ***************************************************************** PP

                                     TIGR00032 322 dalikktqervtGtvrvklfkGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfikirglq 385
                                                   + +i+ +q +v+G+vr+kl+kGn+iv grks++sl+d+++++fe+   +++q da+Gfik+++l+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742 329 QQMIDASQAHVNGVVRLKLYKGNVIVTGRKSDESLFDANIATFEEdGGAYNQADAAGFIKLNALR 393
                                                   ********************************************9456899************** PP

                                     TIGR00032 386 ikvyre 391
                                                   +++ ++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_742 394 MRIAAN 399
                                                   988765 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (394 nodes)
Target sequences:                          1  (405 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.30
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory