Align 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 (characterized)
to candidate Pf1N1B4_1307 3-dehydroquinate dehydratase II (EC 4.2.1.10)
Query= SwissProt::P43877 (154 letters) >lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1307 3-dehydroquinate dehydratase II (EC 4.2.1.10) Length = 150 Score = 191 bits (485), Expect = 4e-54 Identities = 95/146 (65%), Positives = 115/146 (78%), Gaps = 1/146 (0%) Query: 1 MKKILLLNGPNLNMLGKREPHIYGSQTLSDIEQHLQQSAQAQGYELDYFQANGEESLINR 60 M +L+L+GPNLN+LG REP +YG+ TL+ I Q L+Q A+ G+ L Y Q+N E LI+R Sbjct: 1 MATLLVLHGPNLNLLGTREPGVYGATTLAQINQDLEQRARNAGHHLLYLQSNAEYELIDR 60 Query: 61 IHQAF-QNTDFIIINPGAFTHTSVAIRDALLAVSIPFIEVHLSNVHAREPFRHHSYLSDV 119 IH A + DFI+INP AFTHTSVA+RDALLAVSIPFIEVHLSNVH REPFRHHSY SDV Sbjct: 61 IHAARGEGVDFILINPAAFTHTSVALRDALLAVSIPFIEVHLSNVHKREPFRHHSYFSDV 120 Query: 120 AKGVICGLGAKGYDYALDFAISELQK 145 A GVICGLGA GY AL+ A+ +L++ Sbjct: 121 AVGVICGLGASGYRLALEAALEQLER 146 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 154 Length of database: 150 Length adjustment: 17 Effective length of query: 137 Effective length of database: 133 Effective search space: 18221 Effective search space used: 18221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
Align candidate Pf1N1B4_1307 (3-dehydroquinate dehydratase II (EC 4.2.1.10))
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01088.hmm # target sequence database: /tmp/gapView.2306.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01088 [M=141] Accession: TIGR01088 Description: aroQ: 3-dehydroquinate dehydratase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-65 204.2 0.1 3.6e-65 204.0 0.1 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1307 3-dehydroquinate dehydratase II Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1307 3-dehydroquinate dehydratase II (EC 4.2.1.10) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 204.0 0.1 3.6e-65 3.6e-65 2 140 .. 4 143 .. 3 144 .. 0.98 Alignments for each domain: == domain 1 score: 204.0 bits; conditional E-value: 3.6e-65 TIGR01088 2 ilvlnGPnlnlLGkrepkvyGsltleeieelleeaakelevevevfqsnsegelidkihealeq 65 +lvl+GPnlnlLG+rep+vyG++tl +i++ le+ a++++ ++ ++qsn e+elid+ih a ++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1307 4 LLVLHGPNLNLLGTREPGVYGATTLAQINQDLEQRARNAGHHLLYLQSNAEYELIDRIHAARGE 67 79************************************************************99 PP TIGR01088 66 .vdgivinpaalthtsvalrDalaavslPvvevhlsnvhareefrkksvlaevakGvivGlGak 128 vd+i+inpaa+thtsvalrDal+avs+P++evhlsnvh+re+fr++s++++va Gvi+GlGa+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1307 68 gVDFILINPAAFTHTSVALRDALLAVSIPFIEVHLSNVHKREPFRHHSYFSDVAVGVICGLGAS 131 9*************************************************************** PP TIGR01088 129 gyklalealvea 140 gy+lalea++e+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1307 132 GYRLALEAALEQ 143 *******99886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (141 nodes) Target sequences: 1 (150 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 3.88 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory