GapMind for Amino acid biosynthesis

 

Aligments for a candidate for aroD in Pseudomonas fluorescens FW300-N1B4

Align 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate Pf1N1B4_2750 3-dehydroquinate dehydratase II (EC 4.2.1.10)

Query= BRENDA::W6JLW3
         (160 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2750 3-dehydroquinate
           dehydratase II (EC 4.2.1.10)
          Length = 146

 Score =  181 bits (458), Expect = 6e-51
 Identities = 81/143 (56%), Positives = 106/143 (74%)

Query: 15  PLITVLNGPNLNMLGLRQPGIYGHATLDDVEQVCIQAAERLDVAIDFRQTNGEGELVSWV 74
           P++ VLNGPNLN+LG R+P  YGH TL D+  +C +AAE   + ++FRQTN EGEL+ W+
Sbjct: 3   PIVLVLNGPNLNLLGTREPATYGHETLADISALCGRAAEEFGLTVEFRQTNHEGELLDWI 62

Query: 75  QECRGRADGIVINPAAYGHTSIALLDALLAVELPVVEVHISNIHRREPFRHHTYVSQAAI 134
              RGR  GIVINPAA+ HTS+A+ DAL+A ELPV+EVH+SN+H REPFRHH++VS  A 
Sbjct: 63  HAARGRCAGIVINPAAWTHTSVAIRDALVASELPVIEVHLSNVHAREPFRHHSFVSSIAA 122

Query: 135 GVICGLGVRGYAHALQAITDMIE 157
            V+CG G  GY  AL+  +  +E
Sbjct: 123 AVMCGFGSHGYRLALEHFSHRLE 145


Lambda     K      H
   0.322    0.139    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 112
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 160
Length of database: 146
Length adjustment: 17
Effective length of query: 143
Effective length of database: 129
Effective search space:    18447
Effective search space used:    18447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 43 (21.2 bits)

Align candidate Pf1N1B4_2750 (3-dehydroquinate dehydratase II (EC 4.2.1.10))
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01088.hmm
# target sequence database:        /tmp/gapView.9644.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01088  [M=141]
Accession:   TIGR01088
Description: aroQ: 3-dehydroquinate dehydratase, type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
    2.4e-62  194.9   0.0    2.6e-62  194.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2750  3-dehydroquinate dehydratase II 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2750  3-dehydroquinate dehydratase II (EC 4.2.1.10)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.7   0.0   2.6e-62   2.6e-62       2     137 ..       5     140 ..       4     144 .. 0.98

  Alignments for each domain:
  == domain 1  score: 194.7 bits;  conditional E-value: 2.6e-62
                                      TIGR01088   2 ilvlnGPnlnlLGkrepkvyGsltleeieelleeaakelevevevfqsnsegelidkihealeq 65 
                                                    +lvlnGPnlnlLG+rep+ yG+ tl +i++l+ +aa+e ++ ve++q+n+egel+d+ih a ++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2750   5 VLVLNGPNLNLLGTREPATYGHETLADISALCGRAAEEFGLTVEFRQTNHEGELLDWIHAARGR 68 
                                                    89************************************************************** PP

                                      TIGR01088  66 vdgivinpaalthtsvalrDalaavslPvvevhlsnvhareefrkksvlaevakGvivGlGakg 129
                                                      givinpaa+thtsva+rDal+a +lPv+evhlsnvhare+fr++s+++ +a  v++G+G +g
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2750  69 CAGIVINPAAWTHTSVAIRDALVASELPVIEVHLSNVHAREPFRHHSFVSSIAAAVMCGFGSHG 132
                                                    **************************************************************** PP

                                      TIGR01088 130 yklaleal 137
                                                    y+lale  
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2750 133 YRLALEHF 140
                                                    *****976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          1  (146 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00
# Mc/sec: 4.51
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory