Align shikimate kinase (EC 2.7.1.71) (characterized)
to candidate Pf1N1B4_1538 Shikimate kinase I (EC 2.7.1.71)
Query= BRENDA::A0A0M3KL09 (179 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1538 Length = 163 Score = 162 bits (410), Expect = 3e-45 Identities = 85/155 (54%), Positives = 108/155 (69%) Query: 17 MGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTS 76 MGAGK+T+GR LA+ L F DSD EIE +TGA IPWIF+KEGE GFR RE ++ EL + Sbjct: 1 MGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIPWIFDKEGEPGFRDREQAMIAELCA 60 Query: 77 RKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKL 136 +VLATGGGA+ + NR L G VVYL+ VE Q+ RT RD+NRPLL+ +P + L Sbjct: 61 CDGVVLATGGGAVMREANRRALHAGGRVVYLHASVEQQVGRTARDRNRPLLRTADPAKTL 120 Query: 137 RDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQ 171 RDLL IRDPLYRE+A +ET++ R + IL+ Sbjct: 121 RDLLAIRDPLYREIADLVVETDERPPRMVVLDILE 155 Lambda K H 0.318 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 103 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 179 Length of database: 163 Length adjustment: 18 Effective length of query: 161 Effective length of database: 145 Effective search space: 23345 Effective search space used: 23345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory