GapMind for Amino acid biosynthesis

 

Aligments for a candidate for glnA in Pseudomonas fluorescens FW300-N1B4

Align Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 (characterized)
to candidate Pf1N1B4_1606 Glutamine synthetase type I (EC 6.3.1.2)

Query= SwissProt::Q3V5W6
         (468 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606 Glutamine synthetase
           type I (EC 6.3.1.2)
          Length = 468

 Score =  912 bits (2357), Expect = 0.0
 Identities = 440/468 (94%), Positives = 455/468 (97%)

Query: 1   MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDALEDDFFEVGKMFDGSSIAGWKGI 60
           MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARD L++ FFE GKMFDGSSIAGWKGI
Sbjct: 1   MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDGLDEAFFEEGKMFDGSSIAGWKGI 60

Query: 61  EASDMILLPDDDTAVLDPFTEDATLILVCDIIEPSTMQGYDRDPRAIAHRAEEYLKTTGI 120
           EASDMIL+PDD TAVLDPFTE+ TLILVCD+IEPSTMQGYDRDPRAIA RAEEYLK+TGI
Sbjct: 61  EASDMILMPDDSTAVLDPFTEEPTLILVCDVIEPSTMQGYDRDPRAIAKRAEEYLKSTGI 120

Query: 121 GDTVFAGPEPEFFIFDEVKFKSDISGSMFKIYSEQGSWMSDQDIEGGNKGHRPGVKGGYF 180
           GDTVF GPEPEFFIFDEVKFKSDISGSMFKI+SEQGSWMSDQD+EGGNKGHRPGVKGGYF
Sbjct: 121 GDTVFVGPEPEFFIFDEVKFKSDISGSMFKIFSEQGSWMSDQDVEGGNKGHRPGVKGGYF 180

Query: 181 PVPPFDHDHEIRTAMCNALEEMGQTVEVHHHEVATAGQNEIGVKFNTLVKKADEVQTLKY 240
           PVPPFDHDHEIRT+MCNA+EEMG  +EVHHHEVATAGQNEIGVKFNTLV KADEVQTLKY
Sbjct: 181 PVPPFDHDHEIRTSMCNAMEEMGLVIEVHHHEVATAGQNEIGVKFNTLVAKADEVQTLKY 240

Query: 241 VVHNVADAYGRTATFMPKPLYGDNGSGMHVHMSIAKDGKNTFAGEGYAGLSETALYFIGG 300
            VHNVADAYGRTATFMPKPLYGDNGSGMHVH+SIAKDGKNTFAGEGYAGLS+TALYFIGG
Sbjct: 241 CVHNVADAYGRTATFMPKPLYGDNGSGMHVHLSIAKDGKNTFAGEGYAGLSDTALYFIGG 300

Query: 301 IIKHGKALNGFTNPATNSYKRLVPGFEAPVMLAYSARNRSASIRIPYVNSPRGRRIEARF 360
           IIKHGKALNGFTNP+TNSYKRLVPGFEAPVMLAYSARNRSASIRIPYV+SPR RRIEARF
Sbjct: 301 IIKHGKALNGFTNPSTNSYKRLVPGFEAPVMLAYSARNRSASIRIPYVSSPRARRIEARF 360

Query: 361 PDPAANPYLAFAALLMAGLDGIQNKIHPGDAADKNLYDLPPEEAKEIPQVCGSLKEALEE 420
           PDPAANPYL FAALLMAGLDGIQNKIHPGDAADKNLYDLPPEEAKEIPQVCGSLKEALEE
Sbjct: 361 PDPAANPYLGFAALLMAGLDGIQNKIHPGDAADKNLYDLPPEEAKEIPQVCGSLKEALEE 420

Query: 421 LDKGRAFLTKGGVFSDDFIDAYIALKSEEEIKVRTFVHPLEYELYYSC 468
           LDKGRAFLTKGGVFSDDFIDAYIALKSEEEIKVRTFVHPLEYELYYSC
Sbjct: 421 LDKGRAFLTKGGVFSDDFIDAYIALKSEEEIKVRTFVHPLEYELYYSC 468


Lambda     K      H
   0.318    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 950
Number of extensions: 39
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 468
Length of database: 468
Length adjustment: 33
Effective length of query: 435
Effective length of database: 435
Effective search space:   189225
Effective search space used:   189225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate Pf1N1B4_1606 (Glutamine synthetase type I (EC 6.3.1.2))
to HMM TIGR00653 (glnA: glutamine synthetase, type I (EC 6.3.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00653.hmm
# target sequence database:        /tmp/gapView.20389.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00653  [M=462]
Accession:   TIGR00653
Description: GlnA: glutamine synthetase, type I
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   4.3e-204  664.4   0.0   4.8e-204  664.2   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606  Glutamine synthetase type I (EC 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606  Glutamine synthetase type I (EC 6.3.1.2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  664.2   0.0  4.8e-204  4.8e-204       4     462 .]       5     467 ..       2     467 .. 0.99

  Alignments for each domain:
  == domain 1  score: 664.2 bits;  conditional E-value: 4.8e-204
                                      TIGR00653   4 lkllkeenvkfvdlrfvDikGklkkveipvse.leeealeegiaFDgssveGfksieesDlllk 66 
                                                    ++l+k+++vk +dlrf+D+kG+ ++v++p+++ l+e ++eeg++FDgss+ G+k+ie sD++l+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606   5 VQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDgLDEAFFEEGKMFDGSSIAGWKGIEASDMILM 68 
                                                    6899**************************97367999************************** PP

                                      TIGR00653  67 pdpetlvivPfraekvlrvicdvyepvtkepyerdpRsiakraeeelk.tklgdevyfGpEaEF 129
                                                    pd +t+v +Pf++e++l+++cdv ep t++ y+rdpR iakraee+lk t++gd+v++GpE+EF
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606  69 PDDSTAVLDPFTEEPTLILVCDVIEPSTMQGYDRDPRAIAKRAEEYLKsTGIGDTVFVGPEPEF 132
                                                    **************************************************************** PP

                                      TIGR00653 130 flfdkvefkeasnssflevdseegewn..reveegnkgykikkkggYfdvepvDkakdirrelv 191
                                                    f+fd+v+fk+  + s++++ se+g+w   ++ve+gnkg+++  kggYf+v+p D+ ++ir++++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606 133 FIFDEVKFKSDISGSMFKIFSEQGSWMsdQDVEGGNKGHRPGVKGGYFPVPPFDHDHEIRTSMC 196
                                                    **************************988899999***************************** PP

                                      TIGR00653 192 laleelglevevsHHEvata.qaEidikfdklvkaaDeivlyKyvvknvakkhGktatFmpKpl 254
                                                    +a+ee+gl +ev+HHEvata q+Ei++kf++lv +aDe++++Ky v+nva+ +G+tatFmpKpl
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606 197 NAMEEMGLVIEVHHHEVATAgQNEIGVKFNTLVAKADEVQTLKYCVHNVADAYGRTATFMPKPL 260
                                                    **************************************************************** PP

                                      TIGR00653 255 fgdngsGmHvhlslwkdgenlfageegyagLsetalyyigGilkHakalaAltnptvnsYkRLv 318
                                                    +gdngsGmHvhls+ kdg+n fage  yagLs+taly+igGi+kH+kal+ +tnp++nsYkRLv
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606 261 YGDNGSGMHVHLSIAKDGKNTFAGEG-YAGLSDTALYFIGGIIKHGKALNGFTNPSTNSYKRLV 323
                                                    *************************9.************************************* PP

                                      TIGR00653 319 pGyEAPvylaysaknRsaliRiPasanpkakRiEvRspDpsanpYLafaallmAgldGiknkid 382
                                                    pG+EAPv+laysa+nRsa+iRiP++++p+a+RiE R+pDp+anpYL faallmAgldGi+nki+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606 324 PGFEAPVMLAYSARNRSASIRIPYVSSPRARRIEARFPDPAANPYLGFAALLMAGLDGIQNKIH 387
                                                    **************************************************************** PP

                                      TIGR00653 383 pgepldknlyelseeelkelGieqlpesLeealdelesdk..evlkevlgeelieafielkrkE 444
                                                    pg++ dknly+l++ee+ke  i+q+  sL+eal+el++ +  +++++v+++++i+a+i+lk +E
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606 388 PGDAADKNLYDLPPEEAKE--IPQVCGSLKEALEELDKGRafLTKGGVFSDDFIDAYIALKSEE 449
                                                    *******************..******************99999******************** PP

                                      TIGR00653 445 veelrlkvhpvElekyld 462
                                                      ++r+ vhp+E e y++
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1606 450 EIKVRTFVHPLEYELYYS 467
                                                    ****************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (462 nodes)
Target sequences:                          1  (468 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 7.18
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory