Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate Pf1N1B4_867 Serine acetyltransferase (EC 2.3.1.30)
Query= curated2:A7HJ58 (249 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_867 Length = 258 Score = 65.9 bits (159), Expect = 8e-16 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 2/122 (1%) Query: 125 MMGAVINLGAIIGEGTMID--MNTVIGARARIGKYCHIGAGSVIAGVVEPPSAQPVIIED 182 + G I+ GA +G ID M VIG A IG + G + G + +ED Sbjct: 63 LTGIEIHPGAKVGRRFFIDHGMGIVIGETAEIGNDVTLYQGVTLGGTSWNKGKRHPTLED 122 Query: 183 NVVIGANAVILEGVRVGEHSVVAAGAVVVEDVPPYTVVAGVPAKVIKKVDEKTISKTQLI 242 VV+GA A +L VG + V + AVV + VPP V G+P ++I K DE+ +K + + Sbjct: 123 GVVVGAGAKVLGPFTVGAGAKVGSNAVVTKAVPPGATVVGIPGRIIVKSDEEQDAKRKAL 182 Query: 243 EE 244 E Sbjct: 183 AE 184 Lambda K H 0.318 0.137 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 258 Length adjustment: 24 Effective length of query: 225 Effective length of database: 234 Effective search space: 52650 Effective search space used: 52650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory