GapMind for Amino acid biosynthesis

 

Aligments for a candidate for PPYAT in Pseudomonas fluorescens FW300-N1B4

Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate Pf1N1B4_349 Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57)

Query= reanno::BFirm:BPHYT_RS14905
         (370 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_349 Biosynthetic Aromatic
           amino acid aminotransferase beta (EC 2.6.1.57)
          Length = 370

 Score =  377 bits (968), Expect = e-109
 Identities = 194/359 (54%), Positives = 253/359 (70%), Gaps = 3/359 (0%)

Query: 10  VRAIAPYIAGKPISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELGRYPDA 69
           V+ ++PY+ GKP+ E+ARE  LD A IVKLASNENPLG    A  A+ +A +EL RYPD 
Sbjct: 13  VQQLSPYVPGKPVDELARELNLDPANIVKLASNENPLGASPKALAAIREALTELTRYPDG 72

Query: 70  NAFELKAALSERYGVPADWVTLGNGSNDILEIAAHAFVEKGQSIVYAQYSFAVYALATQG 129
           N F LK  L+++  V  + VTLGNGSNDILE+ A A++  G + V++ ++FAVY + TQ 
Sbjct: 73  NGFALKTLLADQCRVELNQVTLGNGSNDILELVARAYLAPGLNAVFSAHAFAVYPIVTQA 132

Query: 130 LGARAIVVPAVKYGHDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDKVPRHV 189
           +GA+A V+PA  +GHDL AMLAA+  DTR++F+ANPNNPTGT+ +   L+ FL  VP HV
Sbjct: 133 VGAQAKVIPAKDWGHDLSAMLAAIDADTRVVFIANPNNPTGTWFDAQALDDFLQDVPAHV 192

Query: 190 VVVLDEAYTEYLPQEKRYDSIAWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQPELTDLL 249
           +VVLDEAY EY       D + ++  YPNLLVSRTFSKA+GLA LRVG+ ++   + D+L
Sbjct: 193 LVVLDEAYIEYAEGSDLPDGLDYLAAYPNLLVSRTFSKAYGLASLRVGYGLSSAIVADVL 252

Query: 250 NRVRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLGLEYVPSDGNFV 309
           NRVRQPFNVN+LA AAA AAL D  +L +S  LN  G ++L   F +LGL ++PS GNF+
Sbjct: 253 NRVRQPFNVNSLALAAACAALQDVEYLAESRRLNESGMQQLQAGFRELGLSWIPSKGNFI 312

Query: 310 LVRVGNDDAAGNRVNLELLKQGVIVRPVGNYGLPQWLRITIGLPEENEAFIAALERTLA 368
            V +G   A    V   LL++GVIVRPV NYG+P  LRITIGLP EN  F+ AL + +A
Sbjct: 313 CVDLGRVAAP---VFEGLLREGVIVRPVANYGMPNHLRITIGLPAENSRFLEALTKVMA 368


Lambda     K      H
   0.318    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 435
Number of extensions: 15
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 370
Length adjustment: 30
Effective length of query: 340
Effective length of database: 340
Effective search space:   115600
Effective search space used:   115600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory