Align Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase; PhPPA-AT; EC 2.6.1.1; EC 2.6.1.78; EC 2.6.1.79 (characterized)
to candidate Pf1N1B4_2863 Valine--pyruvate aminotransferase (EC 2.6.1.66)
Query= SwissProt::E9L7A5 (479 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2863 Length = 390 Score = 198 bits (504), Expect = 2e-55 Identities = 137/401 (34%), Positives = 199/401 (49%), Gaps = 22/401 (5%) Query: 74 ISLSPRVNSVKPSKTVAITDQATALVQAGVPVIRLAAGEPDFDTPAPIVEAGINAIREGH 133 +S S R +++P +A+ +A L AG VI L GEPDF T PI++AG A+ G Sbjct: 3 LSYSARSRAIEPFHVMALLARANELQAAGHDVIHLEIGEPDFTTAEPIIQAGQAALTAGK 62 Query: 134 TRYTPNAGTMELRSAISHKLKEENGLSYTPDQILVSNGAKQSIIQAVLAVCSPGDEVLIP 193 TRYT G ELR AIS ++ GL+ P +IL++ G +++ A + PG L+ Sbjct: 63 TRYTAARGIPELREAISGFYQQRYGLNIDPQRILITPGGSGALLLASALLVDPGKHWLLA 122 Query: 194 APYWVSYPEMARLADATPVILPTSISEDFLLDPKLLESKLTEKSRLLILCSPSNPTGSVY 253 P + RL + ++P + L P L+ S ++ SP+NPTG++ Sbjct: 123 DPGYPCNRHFLRLVEGAAQLVPVGPDVRYQLTPDLVARHWDHDSVGALVASPANPTGTIL 182 Query: 254 PRKLLEQI-AEIVARHPRLLVISDEIYEHIIYAPATHTSFASLPGMWDRTLTVNGFSKAF 312 R L + A I ARH L+V DEIY + Y T AS+ + D +N FSK F Sbjct: 183 TRDELAGLSAAIKARHGHLVV--DEIYHGLTYG----TEAASVLEVDDSAFVLNSFSKYF 236 Query: 313 AMTGWRLGYIAGPKHFIAACNKIQSQFTSGASSISQKAAVAALGLGYAGGELVATMVKSF 372 MTGWRLG++ P+ + K+ A S++Q AA+A A ++ F Sbjct: 237 GMTGWRLGWLVAPEAAVGELEKLAQNLYISAPSMAQHAALAC--FEPATIQIFEERRAEF 294 Query: 373 RERRDYLVKSFGEIEGVKISEPRGAFYLFIDLSSYYGVEVDGFGSINNSESLCRYLLDKA 432 RRD+L+ + E+ EP GAFYL+ D+S + G D F + CR+ L+ Sbjct: 295 GRRRDFLLPALRELGFGIAVEPEGAFYLYADISKFGG---DAF-------AFCRHFLETE 344 Query: 433 QVALVPGDAFGDDTC---IRISYAASLSTLQAAVERIKKAL 470 VA+ PG FG +R +Y SL LQ AVERI + L Sbjct: 345 HVAITPGLDFGRYQAGHHVRFAYTQSLPRLQEAVERIARGL 385 Lambda K H 0.317 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 390 Length adjustment: 32 Effective length of query: 447 Effective length of database: 358 Effective search space: 160026 Effective search space used: 160026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory