Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate Pf1N1B4_1434 Phosphoserine phosphatase (EC 3.1.3.3)
Query= SwissProt::Q9S281 (410 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1434 Length = 404 Score = 264 bits (675), Expect = 3e-75 Identities = 166/392 (42%), Positives = 223/392 (56%), Gaps = 16/392 (4%) Query: 12 LLVKIFGKDRPGITAGLFDTLAAYSVDVVDIEQVVTRGRIVLCALVTEPPRGLEGDLRAT 71 +L+ I G DRPG+TA + LA V+++DI Q V + LV P + Sbjct: 5 VLINITGVDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLSFGILVEIPDTEQGNSVLKD 64 Query: 72 VHSWAESLKLQAEIISGIGDNRPRGFG-----RSLVTVLGHPLTAEATAAIAARITESGS 126 + L+ Q ++ + G R +VT+L +TAE +++ + G Sbjct: 65 ILFKGYELEQQVRFTPVSEEDYQQWVGNQGKKRHIVTLLTRKVTAEQLQRVSSITAKYGL 124 Query: 127 NIDRIFRLA-KYPVTA--------VEFAVSGVETEP--LRTALATEAAALGVDIAVVAAG 175 NID I RL+ + P+ +EF+V G +P LR + A L VDIA Sbjct: 125 NIDHIDRLSGRMPLDTPADKGKGCIEFSVRGEAADPQALRAEFLSVAQELNVDIAFQEDS 184 Query: 176 LHRRAQRLVVMDVDSTLIQDEVIELFAAHAGCEDEVAEVTAAAMRGELDFEQSLHARVAL 235 L RR +RL V D+DSTLI+ EVI+ A AG D+V+ +T AM GELDF S R+AL Sbjct: 185 LFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGDQVSAITERAMAGELDFRASFKERLAL 244 Query: 236 LAGLDASVVDKVRAEVRLTPGARTLIRTLKRLGYQVGVVSGGFTQVTDALQEQLGLDFAQ 295 L GLD SV+D + A +RLT GA TL LKRLGY+ ++SGGFT LQ +LG+D+ Sbjct: 245 LQGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTAILSGGFTYFAKQLQAKLGIDYVF 304 Query: 296 ANTLEIVDGRLTGRVTGEIVDRAGKARLLRRFAAAAGVPLSQTVAIGDGANDLDMLNAAG 355 AN LE+VDG++TG IVD KA LLR A G+ L QT+A+GDGANDL ML AG Sbjct: 305 ANELEVVDGKVTGVAVEPIVDAQRKADLLRELAHKEGLRLEQTIAVGDGANDLPMLAIAG 364 Query: 356 LGVAFNAKPVVREAAHTAVNVPFLDTVLYLLG 387 LGVAF AKP+V+++A A++ LD VLYLLG Sbjct: 365 LGVAFRAKPLVKQSAKQAISTLGLDGVLYLLG 396 Lambda K H 0.319 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 404 Length adjustment: 31 Effective length of query: 379 Effective length of database: 373 Effective search space: 141367 Effective search space used: 141367 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Pf1N1B4_1434 (Phosphoserine phosphatase (EC 3.1.3.3))
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.29255.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-83 266.0 0.5 1.6e-83 265.6 0.5 1.1 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1434 Phosphoserine phosphatase (EC 3. Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1434 Phosphoserine phosphatase (EC 3.1.3.3) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 265.6 0.5 1.6e-83 1.6e-83 1 219 [] 177 395 .. 177 395 .. 0.99 Alignments for each domain: == domain 1 score: 265.6 bits; conditional E-value: 1.6e-83 TIGR00338 1 diakselskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslre 64 dia +e+s ++++++l+vfD+Dstlie+EvIde+ak+aGv+++Vs+iTerAm geldF++s++e lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1434 177 DIAFQEDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGDQVSAITERAMAGELDFRASFKE 240 688999999******************************************************* PP TIGR00338 65 RvkllkglpvellkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavf 128 R++ll+gl+v++l+ + +l+lteG+e l +Lk+ gyk+a++SGgF+++a++l++kLg+d+vf lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1434 241 RLALLQGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTAILSGGFTYFAKQLQAKLGIDYVF 304 **************************************************************** PP TIGR00338 129 aNrLevedgkltGkvegeivdesakaktllkllekegislektvavGDGanDlsmikaAglgia 192 aN+Lev dgk tG +ivd++ ka+ l +l++keg+ le+t+avGDGanDl+m++ Aglg+a lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1434 305 ANELEVVDGKVTGVAVEPIVDAQRKADLLRELAHKEGLRLEQTIAVGDGANDLPMLAIAGLGVA 368 **************************************************************** PP TIGR00338 193 fnakpvlkekadiviekkdltdilell 219 f akp +k+ a+++i++ l ++l+ll lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1434 369 FRAKPLVKQSAKQAISTLGLDGVLYLL 395 ******************999999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (404 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.71 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory