GapMind for Amino acid biosynthesis

 

Aligments for a candidate for thrB in Pseudomonas fluorescens FW300-N1B4

Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate Pf1N1B4_1873 Homoserine kinase (EC 2.7.1.39)

Query= SwissProt::P29364
         (316 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873 Homoserine kinase (EC
           2.7.1.39)
          Length = 316

 Score =  449 bits (1155), Expect = e-131
 Identities = 224/316 (70%), Positives = 251/316 (79%)

Query: 1   MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60
           MSVFTPL R  LE FLAPY LGRL DF+GIA GSEN+NFF+SLE GEFVLTLVERGPVQ+
Sbjct: 1   MSVFTPLARPELETFLAPYGLGRLLDFQGIAAGSENTNFFISLEQGEFVLTLVERGPVQE 60

Query: 61  LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120
           +PFFIELLDVLH+  LPVPYALRT DG ALR L GKPALLQPRLAG+H +  NA HC +V
Sbjct: 61  MPFFIELLDVLHDANLPVPYALRTTDGVALRELAGKPALLQPRLAGKHIKDANAQHCAQV 120

Query: 121 GDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAER 180
           G+LL HLH AT+  +++R +DRGL WMLE+G  L   L  +   LL  AL EI     + 
Sbjct: 121 GELLAHLHLATQANMIKRKTDRGLDWMLEEGTQLLSHLNAEQSDLLQRALDEITQQKTKI 180

Query: 181 PALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLDPA 240
            ALPRAN+HADLFRDN +F+G HL GLIDFYNACSG MLYD+AI LNDWCS+  G LD A
Sbjct: 181 LALPRANIHADLFRDNAMFEGTHLTGLIDFYNACSGPMLYDVAIALNDWCSDEQGQLDGA 240

Query: 241 RARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAFAGQDVLIHDPAEFEI 300
           RARALL AYA  RPFTA EAE WP+MLRVACVRFWLSRLIAAE+FAGQDVLIHDP EF++
Sbjct: 241 RARALLGAYAALRPFTAAEAELWPTMLRVACVRFWLSRLIAAESFAGQDVLIHDPMEFQL 300

Query: 301 RLAQRQNVEIHLPFAL 316
           RL QRQ V   LPFAL
Sbjct: 301 RLMQRQKVHTPLPFAL 316


Lambda     K      H
   0.324    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 391
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 316
Length of database: 316
Length adjustment: 27
Effective length of query: 289
Effective length of database: 289
Effective search space:    83521
Effective search space used:    83521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)

Align candidate Pf1N1B4_1873 (Homoserine kinase (EC 2.7.1.39))
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00938.hmm
# target sequence database:        /tmp/gapView.1695.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00938  [M=307]
Accession:   TIGR00938
Description: thrB_alt: homoserine kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
    3.3e-91  291.8   0.0    3.8e-91  291.6   0.0    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873  Homoserine kinase (EC 2.7.1.39)


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873  Homoserine kinase (EC 2.7.1.39)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  291.6   0.0   3.8e-91   3.8e-91       1     305 [.       1     302 [.       1     304 [. 0.96

  Alignments for each domain:
  == domain 1  score: 291.6 bits;  conditional E-value: 3.8e-91
                                      TIGR00938   1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPf 64 
                                                    m+v+t ++  ele+fL  y lG+ll+++Gia G en+n+++  ++g +vLtl e+    +e+Pf
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873   1 MSVFTPLARPELETFLAPYGLGRLLDFQGIAAGSENTNFFISLEQGEFVLTLVERGP-VQEMPF 63 
                                                    9*****************************************************998.899*** PP

                                      TIGR00938  65 flellthLaerglpvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlakl 128
                                                    f+ell+ L + +lpv+ ++++ dG al eLaGkPa l   L+G+ ++   a++c++vge la+l
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873  64 FIELLDVLHDANLPVPYALRTTDGVALRELAGKPALLQPRLAGKHIKDANAQHCAQVGELLAHL 127
                                                    **************************************************************** PP

                                      TIGR00938 129 hlagadfkeerkndlrleaWsilaakkfkvleqleeelaalldkeldalkkflpr..dLPrgvi 190
                                                    hla++    +rk   r  +W  +   +  +l +l++e+++ll++ ld +++  ++   LPr+ i
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873 128 HLATQANMIKRKT-DRGLDWMLEEGTQ--LLSHLNAEQSDLLQRALDEITQQKTKilALPRANI 188
                                                    ****988888888.58889*9998888..*******************99999884468***** PP

                                      TIGR00938 191 hadlfkdnvlldgdklkgvidfyfaCedallydlaiavndWcfeaddkldaaaakallkgyeav 254
                                                    hadlf+dn +++g +l+g+idfy aC++ +lyd+aia+ndWc +++++ld a+a+all++y a 
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873 189 HADLFRDNAMFEGTHLTGLIDFYNACSGPMLYDVAIALNDWCSDEQGQLDGARARALLGAYAAL 252
                                                    **************************************************************** PP

                                      TIGR00938 255 rpLseeekaafpvllrgaalrfllsrlldlvftqagelvvakdPaeferkL 305
                                                    rp+++ e + +p++lr+a++rf+lsrl     + ag+ v + dP ef+ +L
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1873 253 RPFTAAEAELWPTMLRVACVRFWLSRLIAAE-SFAGQDVLIHDPMEFQLRL 302
                                                    ***************************9865.57899999*******9887 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (307 nodes)
Target sequences:                          1  (316 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.08
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory