GapMind for Amino acid biosynthesis

 

Aligments for a candidate for trpD_2 in Pseudomonas fluorescens FW300-N1B4

Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate Pf1N1B4_2548 Anthranilate phosphoribosyltransferase (EC 2.4.2.18)

Query= SwissProt::Q8PD71
         (345 letters)



>lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548 Anthranilate
           phosphoribosyltransferase (EC 2.4.2.18)
          Length = 349

 Score =  294 bits (753), Expect = 2e-84
 Identities = 160/335 (47%), Positives = 211/335 (62%), Gaps = 4/335 (1%)

Query: 8   ALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMREF 67
           AL R + H ++  DEM D+MR+IM G+ +DA + A +  +R+K E+I EI GA T MRE 
Sbjct: 6   ALSRIVGHLDLTTDEMRDVMREIMTGQCTDAQIGAFMMAMRMKSESIDEIVGAVTAMREL 65

Query: 68  SRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKSGSADA 127
           + +VE+     +VD+VGTGGDG++ FN+ST + FV AA G  VAKHGNR+VS KSGSAD 
Sbjct: 66  ADKVELNTLDGVVDVVGTGGDGANIFNVSTASSFVVAAAGCTVAKHGNRAVSGKSGSADL 125

Query: 128 LEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPLTN 187
           LEA G  + L P QVA  +   GIGFM+A  HH AMK  A  RRE+G+RT+FN+LGPLTN
Sbjct: 126 LEAAGIYLNLTPVQVARCIDNVGIGFMFAQTHHSAMKHAAGPRRELGLRTLFNMLGPLTN 185

Query: 188 PAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDGQV 247
           PAG  + ++GVF   L    A VLQ LG++  LVV  +DG+DE SL A T V EL++ Q+
Sbjct: 186 PAGVKHQVVGVFSQALCRPLAEVLQRLGSKHVLVVHSKDGLDEFSLAAPTFVAELKNDQI 245

Query: 248 HEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVP----GPALDIVALNAGAALY 303
            E+ V PED G+   +   L V   A S  ++   L          A +++ LNAGAALY
Sbjct: 246 TEFWVEPEDLGMKSQSLHGLAVESPAASLELIRDALGKRKTENGQKAAEMIVLNAGAALY 305

Query: 304 VAGVADSIADGIVRARQVLADGSARACLDAYVAFT 338
            A VA S+ +G+  A   L  G AR  L+   AFT
Sbjct: 306 AADVASSLKEGVALAHDALHTGLAREKLEELGAFT 340


Lambda     K      H
   0.320    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 302
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 345
Length of database: 349
Length adjustment: 29
Effective length of query: 316
Effective length of database: 320
Effective search space:   101120
Effective search space used:   101120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Pf1N1B4_2548 (Anthranilate phosphoribosyltransferase (EC 2.4.2.18))
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01245.hmm
# target sequence database:        /tmp/gapView.17198.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01245  [M=330]
Accession:   TIGR01245
Description: trpD: anthranilate phosphoribosyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                      -----------
   2.3e-126  407.5   3.4   2.6e-126  407.3   3.4    1.0  1  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548  Anthranilate phosphoribosyltrans


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548  Anthranilate phosphoribosyltransferase (EC 2.4.2.18)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  407.3   3.4  2.6e-126  2.6e-126       2     328 ..       8     337 ..       7     339 .. 0.97

  Alignments for each domain:
  == domain 1  score: 407.3 bits;  conditional E-value: 2.6e-126
                                      TIGR01245   2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvek 65 
                                                    ++++ + dL+++e++++m+eim+g+++daqi+A+++a+r+k+e+++ei+g+++a+re a+kve 
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548   8 SRIVGHLDLTTDEMRDVMREIMTGQCTDAQIGAFMMAMRMKSESIDEIVGAVTAMRELADKVEL 71 
                                                    67788889******************************************************** PP

                                      TIGR01245  66 eeseelvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlel 129
                                                    ++ + +vD+vGTGGDg++ +N+STas++v+aaaG  vaKhGnr+vs+ksGsaD+Lea g+ l+l
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548  72 NTLDGVVDVVGTGGDGANIFNVSTASSFVVAAAGCTVAKHGNRAVSGKSGSADLLEAAGIYLNL 135
                                                    **************************************************************** PP

                                      TIGR01245 130 spekvarsleevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvysk 193
                                                    +p +var++++vgigF+fA ++h+a+k++a+ R+eLg+rt+fN+LGPL+nPa +k+qv+Gv+s+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548 136 TPVQVARCIDNVGIGFMFAQTHHSAMKHAAGPRRELGLRTLFNMLGPLTNPAGVKHQVVGVFSQ 199
                                                    **************************************************************** PP

                                      TIGR01245 194 dlvevlaevlknlgvkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraele 257
                                                     l++ laevl++lg+k++lvvh++dglDE+sl ++t vaelk+++i+e+ ++ped+g+k ++l+
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548 200 ALCRPLAEVLQRLGSKHVLVVHSKDGLDEFSLAAPTFVAELKNDQITEFWVEPEDLGMKSQSLH 263
                                                    **************************************************************** PP

                                      TIGR01245 258 elkggsaeenaellkevlegke...kkakrdivvlNaaaalyvagkakdlkegvelakeaiksg 318
                                                     l+++s+++++el++++l  ++    +++++++vlNa+aaly+a++a++lkegv la++a+++g
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548 264 GLAVESPAASLELIRDALGKRKtenGQKAAEMIVLNAGAALYAADVASSLKEGVALAHDALHTG 327
                                                    ******************7776333567789********************************* PP

                                      TIGR01245 319 kalekleelv 328
                                                     a ekleel 
  lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2548 328 LAREKLEELG 337
                                                    *******986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (330 nodes)
Target sequences:                          1  (349 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 11.28
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory