Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate AO353_29150 AO353_29150 amidase
Query= curated2:O83983 (506 letters) >FitnessBrowser__pseudo3_N2E3:AO353_29150 Length = 568 Score = 99.0 bits (245), Expect = 4e-25 Identities = 84/247 (34%), Positives = 121/247 (48%), Gaps = 24/247 (9%) Query: 14 LKAQLEAGAISSLQIVRAFR---NVYE-EDTRSASPLGALVEFFSDAEEHARTADNLRAS 69 L+A LE+G +++++V+A+ + Y+ DT +A L A+V +A AR +D RA Sbjct: 12 LRAALESGQTTAVELVQAYLARIDAYDGPDTPTA--LNAVVVRNPEALNEARASDARRAK 69 Query: 70 CAQSTKTAGANGGSVSGKPLLGLPFAVKDNISVKGKHCTCGSKLLADYRAPYDATVVARL 129 G G PL G+P+ KD+ VKG GS A+ A DA + RL Sbjct: 70 ------------GQTLG-PLDGIPYTAKDSYLVKGLTAASGSPAFANLIAYRDAFTIERL 116 Query: 130 RAAGAIPLGRTNMDEFAMGSSTEYSVYGPTRNPRD----RSRTSGGSSGGSAAAVAGGQA 185 RAAGAI LG+TNM A G + VYG +P + + + GSS G+ A A A Sbjct: 117 RAAGAICLGKTNMPPMANG-GMQRGVYGRAESPYNADYLTAPFASGSSNGAGTATAASFA 175 Query: 186 PFALGTETGGSVRLPAAYCGLYGLKPTYGLLSRYGVVAFGSSLDQIGFFATCIDDIALAL 245 F L ET S R PA+ GL P+ G++S G ++D + FA + D+ L Sbjct: 176 AFGLAEETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPFARTMADLLEVL 235 Query: 246 SVTSGKD 252 V +D Sbjct: 236 DVVVAED 242 Score = 31.2 bits (69), Expect = 1e-04 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query: 463 LPALSVPVGT-SGTGLPIGIQIIGSQWQECAVLRLAKRWE 501 +P ++VP+G + G+P+G+ G + + +LRLA +E Sbjct: 512 VPTVTVPMGVMADIGMPVGLTFAGRAYDDSTLLRLASAFE 551 Lambda K H 0.320 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 672 Number of extensions: 32 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 506 Length of database: 568 Length adjustment: 35 Effective length of query: 471 Effective length of database: 533 Effective search space: 251043 Effective search space used: 251043 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory