Align Ribose-phosphate pyrophosphokinase; RPPK; EC 2.7.6.1; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase (uncharacterized)
to candidate AO353_19995 AO353_19995 ribose-phosphate pyrophosphokinase
Query= curated2:Q8RHM2 (316 letters) >FitnessBrowser__pseudo3_N2E3:AO353_19995 Length = 321 Score = 158 bits (400), Expect = 1e-43 Identities = 96/282 (34%), Positives = 160/282 (56%), Gaps = 16/282 (5%) Query: 9 IFSGNSNLELAKKIAEKAGLQLGKAEIQRFKDGEVYIEIEETVRGRDVFVVQST----SE 64 +F+ + A ++A++ G QL + E + ++DGE E+V GR+V V S + Sbjct: 8 LFALQGSEHYASRVAQRLGCQLARHEERDYEDGEHKCRPLESVNGREVVVFHSLYGDDRQ 67 Query: 65 PVNENLMELLIFVDALKRASAKTINVIIPYYGYARQDRKSKPREPITSKLVANLLTTAGV 124 N+ L LL F ALK A A+ + + PY Y R+DR+++P++P ++ VA ++ GV Sbjct: 68 SANDKLCRLLFFCGALKDAGARQVQAVTPYLCYGRKDRRTQPQDPTITRYVAAMIEACGV 127 Query: 125 NRVVAMDLH-ADQIQGFFDIPLDHMQALPLMARYFKEKGFKGD-EVVVVSPDVGGVKRAR 182 +R+VA+++H F IP ++Q L AR+F GF GD EVV VSPD GG KRA Sbjct: 128 DRLVALEVHNPAAFDNAFRIPTWNVQCAELFARHF--AGFVGDAEVVSVSPDAGGTKRAE 185 Query: 183 KLAEKLDCKI------AIIDKRRPKPNMSEVMNLIGEVEGKIAIFIDDMIDTAGTITNGA 236 + + L+ ++ A+++K R + + + L+GEV GK AI DD+I T T+ + Sbjct: 186 QFRQALERQLGRVVGGALMEKHRAQATFTGTL-LVGEVLGKTAIIFDDLISTGETLMHAG 244 Query: 237 DAIAQRGAKEVYACCTHAVFSDPAIERLEKSVLKEIVITDSI 278 A Q GA ++A TH +F+ + + L+K + + + ++DS+ Sbjct: 245 LACQQAGATRLFAAATHGLFTGGS-DLLDKPLFEHLAVSDSV 285 Lambda K H 0.319 0.136 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 321 Length adjustment: 27 Effective length of query: 289 Effective length of database: 294 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate AO353_19995 AO353_19995 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.11763.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-62 196.5 0.0 3.2e-62 196.2 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_19995 AO353_19995 ribose-phosphate pyr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_19995 AO353_19995 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 196.2 0.0 3.2e-62 3.2e-62 3 294 .. 8 311 .. 7 318 .. 0.89 Alignments for each domain: == domain 1 score: 196.2 bits; conditional E-value: 3.2e-62 TIGR01251 3 ilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiiv...qstsapvnda 64 +++++ s++ a++va++lg +l + e + + dgE + r esv+g++v+++ ++ nd+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_19995 8 LFALQGSEHYASRVAQRLGCQLARHEERDYEDGEHKCRPLESVNGREVVVFHslyGDDRQSANDK 72 5889999*****************************************99975553445679*** PP TIGR01251 65 lmellllidalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHs 129 l ll+ + alk+a+a++v+av Py+ Y+R+d+++++ +p + va ++e+ G+dr++++++H+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_19995 73 LCRLLFFCGALKDAGARQVQAVTPYLCYGRKDRRTQPQDPTITRYVAAMIEACGVDRLVALEVHN 137 ***************************************************************** PP TIGR01251 130 eq.iqgfFdvpvenlsaspklieelkkke.lknlvvvsPDkGaverakkvakklglel......a 186 ++ ++F++p n++ ++ ++++++ + + ++v vsPD+G+++ra++++++l+ +l a lcl|FitnessBrowser__pseudo3_N2E3:AO353_19995 138 PAaFDNAFRIPTWNVQCAELFARHFAGFVgDAEVVSVSPDAGGTKRAEQFRQALERQLgrvvggA 202 862689********************9999999999****************9997765555558 PP TIGR01251 187 iieKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfs 251 ++eK+R ++ + + t l+g+v gk+++i+DD+isTg Tl++a + +++GA++ ++aathg+f+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_19995 203 LMEKHRA-QA-TFTGTLLVGEVLGKTAIIFDDLISTGETLMHAGLACQQAGATRLFAAATHGLFT 265 9******.33.79**************************************************** PP TIGR01251 252 gdAlerlaeagveevivtntilv.ee...kklpkvseisvapliaea 294 g + l++ +e+++v+++++ + +++++++ + lia lcl|FitnessBrowser__pseudo3_N2E3:AO353_19995 266 GGS-DLLDKPLFEHLAVSDSVPPfRLppdCVAHRLHVLDSTALIATL 311 986.789**************86332322344556666666666655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (321 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.16 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory