GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuC in Pseudomonas fluorescens FW300-N2E3

Align 3-isopropylmalate dehydratase large subunit; EC 4.2.1.33 (characterized)
to candidate AO353_20620 AO353_20620 isopropylmalate isomerase

Query= CharProtDB::CH_024771
         (466 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620 AO353_20620
           isopropylmalate isomerase
          Length = 472

 Score =  590 bits (1520), Expect = e-173
 Identities = 298/468 (63%), Positives = 358/468 (76%), Gaps = 5/468 (1%)

Query: 3   KTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFATMD 62
           KTLY+KL+D+H+V + ++ + L+YIDRH++HEVTSPQAF+GLR  GR   +     AT D
Sbjct: 4   KTLYDKLWDSHLVKQRDDGSALIYIDRHIIHEVTSPQAFEGLRLAGRKPWRIDANIATPD 63

Query: 63  HNVSTQTKDINACG----EMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVT 118
           HNV T  +          E++R+Q+Q L  NC E+G+  + +N   QGIVHV+GPEQG T
Sbjct: 64  HNVPTTPERKGGIAAIADEVSRLQVQTLDDNCDEYGIVEFKMNDVRQGIVHVIGPEQGAT 123

Query: 119 LPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGI 178
           LPGMT+VCGDSHT+THGAFGALA GIGTSEVEHVLATQ L   + K M + V+G    G+
Sbjct: 124 LPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQCLVAKKMKNMLVRVEGTLPFGV 183

Query: 179 TAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDET 238
           TAKDIVLA+IGK G+AGG GH +EF G AIR+LS+EGRMT+CNM+IE GA+ GLVA DE 
Sbjct: 184 TAKDIVLAVIGKIGTAGGNGHAIEFAGSAIRELSVEGRMTICNMSIEAGARVGLVAADEK 243

Query: 239 TFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVI 298
           T  YVKGR  APKG ++D AV  WK L +D  A FDT+V L A +I PQV+WGT+P  V+
Sbjct: 244 TVAYVKGRPFAPKGAEWDLAVEAWKDLVSDADAKFDTIVELDAAQIKPQVSWGTSPEMVL 303

Query: 299 SVNDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAA 358
           +V+ N+PDPA   D V+R S  +AL YMGL     +T++ +D+VFIGSCTNSRIEDLRAA
Sbjct: 304 AVDQNVPDPAKEMDLVKRDSIVRALKYMGLTANQAITDIQLDRVFIGSCTNSRIEDLRAA 363

Query: 359 AEIAKGRKVAPGV-QALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDR 417
           A IAKGRKVA  + QA+VVPGSG VKAQAEAEGLDKIF+EAGFEWR PGCSMCLAMN DR
Sbjct: 364 AVIAKGRKVASTIKQAIVVPGSGLVKAQAEAEGLDKIFLEAGFEWREPGCSMCLAMNPDR 423

Query: 418 LNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNI 465
           L  GE CASTSNRNFEGRQG GGRTHLVSPAMAAAAAV G F D+R +
Sbjct: 424 LESGEHCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAVNGRFVDVREL 471


Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 738
Number of extensions: 23
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 466
Length of database: 472
Length adjustment: 33
Effective length of query: 433
Effective length of database: 439
Effective search space:   190087
Effective search space used:   190087
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate AO353_20620 AO353_20620 (isopropylmalate isomerase)
to HMM TIGR00170 (leuC: 3-isopropylmalate dehydratase, large subunit (EC 4.2.1.33))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00170.hmm
# target sequence database:        /tmp/gapView.12379.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00170  [M=466]
Accession:   TIGR00170
Description: leuC: 3-isopropylmalate dehydratase, large subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   2.2e-237  774.1   1.6   2.7e-237  773.8   1.6    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620  AO353_20620 isopropylmalate isom


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620  AO353_20620 isopropylmalate isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  773.8   1.6  2.7e-237  2.7e-237       2     466 .]       3     471 ..       2     471 .. 0.99

  Alignments for each domain:
  == domain 1  score: 773.8 bits;  conditional E-value: 2.7e-237
                                     TIGR00170   2 aktlyeklfdahvvkeaenetdllyidrhlvhevtspqafeglraagrkvrrvdktlatldhnis 66 
                                                    ktly+kl+d+h+vk+ ++++ l+yidrh++hevtspqafeglr agrk  r+d  +at dhn++
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620   3 GKTLYDKLWDSHLVKQRDDGSALIYIDRHIIHEVTSPQAFEGLRLAGRKPWRIDANIATPDHNVP 67 
                                                   59*************************************************************** PP

                                     TIGR00170  67 tesr....dveikeekaklqvkeleknvkefgvklfdlssaeqgivhvvgpeegltlpgktivcg 127
                                                   t+         i +e+++lqv++l+ n++e+g+  f +++++qgivhv+gpe+g tlpg+t+vcg
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620  68 TTPErkggIAAIADEVSRLQVQTLDDNCDEYGIVEFKMNDVRQGIVHVIGPEQGATLPGMTVVCG 132
                                                   9865466556899**************************************************** PP

                                     TIGR00170 128 dshtathgafgalafgigtsevehvlatqtlkqaraktlkievegklakgitakdiilaiigkig 192
                                                   dsht+thgafgala gigtsevehvlatq l+ ++ k++ ++veg+l  g+takdi+la+igkig
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620 133 DSHTSTHGAFGALAHGIGTSEVEHVLATQCLVAKKMKNMLVRVEGTLPFGVTAKDIVLAVIGKIG 197
                                                   ***************************************************************** PP

                                     TIGR00170 193 vaggtgyvvefageairdlsmeermtvcnmaieagakagliapdettfeyvkdrkyapkgkefek 257
                                                   +agg g+ +efag air+ls+e+rmt+cnm+ieaga+ gl+a de t +yvk+r++apkg+e++ 
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620 198 TAGGNGHAIEFAGSAIRELSVEGRMTICNMSIEAGARVGLVAADEKTVAYVKGRPFAPKGAEWDL 262
                                                   ***************************************************************** PP

                                     TIGR00170 258 avaywktlktdegakfdkvvtleakdispqvtwgtnpgqvlsvneevpdpksladpvekasaeka 322
                                                   av+ wk l +d +akfd+ v l+a +i pqv+wgt+p++vl+v+++vpdp++  d v++ s+ +a
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620 263 AVEAWKDLVSDADAKFDTIVELDAAQIKPQVSWGTSPEMVLAVDQNVPDPAKEMDLVKRDSIVRA 327
                                                   ***************************************************************** PP

                                     TIGR00170 323 laylglepgtklkdikvdkvfigsctnsriedlraaaevvkgkkvadnvklalvvpgsglvkkqa 387
                                                   l+y+gl++++ ++di++d+vfigsctnsriedlraaa ++kg+kva+++k+a+vvpgsglvk+qa
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620 328 LKYMGLTANQAITDIQLDRVFIGSCTNSRIEDLRAAAVIAKGRKVASTIKQAIVVPGSGLVKAQA 392
                                                   ***************************************************************** PP

                                     TIGR00170 388 ekegldkifleagfewreagcslclgmnndvldeyercastsnrnfegrqgkgarthlvspamaa 452
                                                   e+egldkifleagfewre+gcs+cl+mn+d+l+++e castsnrnfegrqg+g+rthlvspamaa
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620 393 EAEGLDKIFLEAGFEWREPGCSMCLAMNPDRLESGEHCASTSNRNFEGRQGAGGRTHLVSPAMAA 457
                                                   ***************************************************************** PP

                                     TIGR00170 453 aaavagkfvdirel 466
                                                   aaav+g+fvd+rel
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_20620 458 AAAVNGRFVDVREL 471
                                                   ************85 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (466 nodes)
Target sequences:                          1  (472 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.98
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory