Align 3-isopropylmalate dehydratase small subunit 2; EC 4.2.1.33; Alpha-IPM isomerase 2; IPMI 2; Isopropylmalate isomerase 2 (uncharacterized)
to candidate AO353_00890 AO353_00890 Fe/S-dependent 2-methylisocitrate dehydratase AcnD
Query= curated2:Q9RTI0 (208 letters) >FitnessBrowser__pseudo3_N2E3:AO353_00890 Length = 864 Score = 52.0 bits (123), Expect = 3e-11 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Query: 27 VESELAKYAMEDYDKDFVRRVQPGDIIVAGADFGCGSSREHAVWALRGAGVSAVIAPNFA 86 VE E M + + ++ R QP II+AGAD+G GSSR+ A +R AGV A+ A F Sbjct: 711 VEPEGQVMRMWEAIETYMERKQPL-IIIAGADYGQGSSRDWAAKGVRLAGVEAIAAEGFE 769 Query: 87 RIYYRNSINNGFLALE 102 RI+ N + G L LE Sbjct: 770 RIHRTNLVGMGVLPLE 785 Lambda K H 0.315 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 208 Length of database: 864 Length adjustment: 31 Effective length of query: 177 Effective length of database: 833 Effective search space: 147441 Effective search space used: 147441 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory