GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapD in Pseudomonas fluorescens FW300-N2E3

Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate AO353_16435 AO353_16435 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

Query= SwissProt::G3XD76
         (344 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435 AO353_16435
           2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase
          Length = 344

 Score =  590 bits (1521), Expect = e-173
 Identities = 296/344 (86%), Positives = 321/344 (93%)

Query: 1   MSQSLFSLAFGVGTQNRQEAWLEVFYALPLLKPSSEIVAAVAPILGYAAGNQALTFTSQQ 60
           MS +LFSLAFGVGTQNRQ AWLEVFYA P+LKPS+E+VAA+APILGY  GNQA+ FT+ Q
Sbjct: 1   MSTTLFSLAFGVGTQNRQGAWLEVFYAAPVLKPSAELVAAIAPILGYTEGNQAIAFTTAQ 60

Query: 61  AYQLADALKGIDAAQSALLSRLAESQKPLVATLLAEDAAPSSTAEAYLKLHLLSHRLVKP 120
           A QLA+ALKG DAAQ+ALL+RLAES KPLVATLLAEDA  SST EAYLKLHLLSHRLVKP
Sbjct: 61  AAQLAEALKGADAAQAALLTRLAESHKPLVATLLAEDAQLSSTPEAYLKLHLLSHRLVKP 120

Query: 121 HAVNLSGIFPLLPNVAWTNIGAVDLAELAELQLEARLKGKLLEVFSVDKFPKMTDYVVPA 180
           H +NL+GIFPLLPNVAWT+ GA+DL ELAE QLEARL+G+LLEVFSVDKFPKMTDYVVPA
Sbjct: 121 HGLNLAGIFPLLPNVAWTSQGAIDLNELAEHQLEARLRGELLEVFSVDKFPKMTDYVVPA 180

Query: 181 GVRIADTARVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGC 240
           GVRIAD AR+RLGAY+GEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGC
Sbjct: 181 GVRIADAARIRLGAYVGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGC 240

Query: 241 STMGTLSGGGNIVISVGEGCLIGANAGIGIPLGDRNIVEAGLYITAGTKVALLDEQNALV 300
           STMGTLSGGGNIVI VGEGCLIGANAGIGIPLGDRN VE+GLY+TAGTKVALLDE N LV
Sbjct: 241 STMGTLSGGGNIVIKVGEGCLIGANAGIGIPLGDRNTVESGLYVTAGTKVALLDENNKLV 300

Query: 301 KVVKARDLAGQPDLLFRRNSQNGAVECKTNKTAIELNEALHAHN 344
           KV+KAR+LAGQPDLLFRRNS+ GAVECKT+K+AIELNEALHAHN
Sbjct: 301 KVLKARELAGQPDLLFRRNSETGAVECKTHKSAIELNEALHAHN 344


Lambda     K      H
   0.317    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 468
Number of extensions: 16
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 344
Length of database: 344
Length adjustment: 29
Effective length of query: 315
Effective length of database: 315
Effective search space:    99225
Effective search space used:    99225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate AO353_16435 AO353_16435 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
to HMM TIGR03536 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR03536.hmm
# target sequence database:        /tmp/gapView.15072.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03536  [M=341]
Accession:   TIGR03536
Description: DapD_gpp: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   9.9e-192  622.1   1.2   1.1e-191  621.9   1.2    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435  AO353_16435 2,3,4,5-tetrahydropy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435  AO353_16435 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltran
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  621.9   1.2  1.1e-191  1.1e-191       1     341 []       5     344 .]       5     344 .] 0.99

  Alignments for each domain:
  == domain 1  score: 621.9 bits;  conditional E-value: 1.1e-191
                                     TIGR03536   1 llslalGvgtknrkgewlevffptpllnpdeelveavaealgyegGnqaieltaeklealaaalk 65 
                                                   l+sla+Gvgt+nr+g+wlevf+++p+l p++elv+a+a  lgy++Gnqai++t++++++la+alk
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435   5 LFSLAFGVGTQNRQGAWLEVFYAAPVLKPSAELVAAIAPILGYTEGNQAIAFTTAQAAQLAEALK 69 
                                                   59**************************************************************9 PP

                                     TIGR03536  66 eagleeqaelaaklkeskrplvavlleedaapasvpeaylklqllshrlvkphgvnleGifgllk 130
                                                    a +++qa+l+++l+es++plva+ll+eda+ +s+peaylkl+llshrlvkphg+nl+Gif+ll+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435  70 GA-DAAQAALLTRLAESHKPLVATLLAEDAQLSSTPEAYLKLHLLSHRLVKPHGLNLAGIFPLLP 133
                                                   99.8899********************************************************** PP

                                     TIGR03536 131 nvawtneGaidleelaerqlearlnGevlevdsvdkfpkmtdyvvpkGvriadtarvrlGayvGe 195
                                                   nvawt++Gaidl+elae+qlearl+Ge+lev+svdkfpkmtdyvvp+Gvriad+ar+rlGayvGe
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435 134 NVAWTSQGAIDLNELAEHQLEARLRGELLEVFSVDKFPKMTDYVVPAGVRIADAARIRLGAYVGE 198
                                                   ***************************************************************** PP

                                     TIGR03536 196 GttvmheGfvnfnaGteGasmveGrisaGvlvGkGsdlGGGastmGtlsGGGnivisvGeecllG 260
                                                   GttvmheGfvnfnaGteG++m+eGr+saGv+vGkGsdlGGG+stmGtlsGGGnivi+vGe+cl+G
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435 199 GTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTMGTLSGGGNIVIKVGEGCLIG 263
                                                   ***************************************************************** PP

                                     TIGR03536 261 anaGiGiplGdrctveaGlyitaGtkvallddkgelvevvkardlaGksdllfrrnslnGavecl 325
                                                   anaGiGiplGdr+tve+Gly+taGtkvalld++++lv+v kar+laG+ dllfrrns++Gavec+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435 264 ANAGIGIPLGDRNTVESGLYVTAGTKVALLDENNKLVKVLKARELAGQPDLLFRRNSETGAVECK 328
                                                   ***************************************************************** PP

                                     TIGR03536 326 tnksaielneelhann 341
                                                   t+ksaielne+lha+n
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_16435 329 THKSAIELNEALHAHN 344
                                                   ***************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (341 nodes)
Target sequences:                          1  (344 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 7.24
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory