Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate AO353_07155 AO353_07155 N-acetyl-gamma-glutamyl-phosphate reductase
Query= SwissProt::Q93Z70 (401 letters) >FitnessBrowser__pseudo3_N2E3:AO353_07155 Length = 344 Score = 311 bits (797), Expect = 2e-89 Identities = 162/345 (46%), Positives = 220/345 (63%), Gaps = 4/345 (1%) Query: 59 IRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVK 118 +++G++G +GYTG E++RLLA HP +V ++T+ +AG ++ ++P+LR SV Sbjct: 2 VKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDGLAFSVP 61 Query: 119 DAD-FSTVDAVFCCLPHGTTQEIIKELPTA-LKIVDLSADFRLRNIAEYEEWYGQPHKAV 176 D D VF PHG + EL A K++DLSADFRL++ E+ +WYGQPH A Sbjct: 62 DIKTLGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGAP 121 Query: 177 ELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGV 236 EL +E VYGL E+ RE I++ARL+A PGCYPT QL +PLL+A L +I D KSGV Sbjct: 122 ELLEEAVYGLPEVNREQIRQARLIAVPGCYPTATQLGFLPLLEAGLADTSRLIADCKSGV 181 Query: 237 SGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRG 296 SGAGRGA +LYSE +E + +Y V HRH+PEI QGL A V ++F PHL PMIRG Sbjct: 182 SGAGRGASVGSLYSETSESMKAYAVKGHRHLPEIRQGLRRAAGKDVGLTFVPHLTPMIRG 241 Query: 297 MQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDR 356 + ST+Y + R+ DL + Y +E FV V+ G P T +VRG+N C ++V + Sbjct: 242 IHSTLYATVVD--RSIDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQ 299 Query: 357 IPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401 +++SVIDNLVKGASGQA+QNLNI+ G E GL H + P Sbjct: 300 DGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERLGLSHAGMLP 344 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 344 Length adjustment: 30 Effective length of query: 371 Effective length of database: 314 Effective search space: 116494 Effective search space used: 116494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AO353_07155 AO353_07155 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.818.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-136 440.0 0.0 3.5e-136 439.9 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 AO353_07155 N-acetyl-gamma-gluta Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 AO353_07155 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 439.9 0.0 3.5e-136 3.5e-136 1 345 [] 2 344 .] 2 344 .] 0.98 Alignments for each domain: == domain 1 score: 439.9 bits; conditional E-value: 3.5e-136 TIGR01850 1 ikvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvd.lkleeleeeei 64 +kv+ivG++GYtG+eLlrlla+Hp++ev+ ++s++eag +++++p+l+g++d l ++ +++ + lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 2 VKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDgLAFSVPDIK-T 65 69***************************8888888*****************8888887777.5 PP TIGR01850 65 leeadvvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYG 129 l ++dvvf+A+phgv+++l+ ell++g+kvidlSadfRl+da++++kwYg++h ++elleeavYG lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 66 LGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGAPELLEEAVYG 130 67*************************************************************** PP TIGR01850 130 lpElnreeikkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfa 194 lpE+nre+i++a+lia+PGCy+Ta++L+ Pll+++l +++++i d+ksGvSgAGr as sl++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 131 LPEVNREQIRQARLIAVPGCYPTATQLGFLPLLEAGLADTSRLIADCKSGVSGAGRGASVGSLYS 195 ***************************************************************** PP TIGR01850 195 evnenlkpYkvtkHrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelr 259 e++e++k+Y+v++HrH pEi+q l+++a+k+v ++f+phl+pm+rGi++t+ya++ + ++ +l+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 196 ETSESMKAYAVKGHRHLPEIRQGLRRAAGKDVGLTFVPHLTPMIRGIHSTLYATVVD--RSIDLQ 258 ********************************************************9..789*** PP TIGR01850 260 klyeevYedepfvrvlkegelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvq 324 +l+e++Y++epfv+v+++g+ P+t++v+g n+++i+v+ ++ + vvv+s+iDNLvKGa+gqAvq lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 259 ALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQDGDLVVVLSVIDNLVKGASGQAVQ 323 ***************************************************************** PP TIGR01850 325 nlNlmlgfdetegLeklpllp 345 nlN+ +g+de+ gL++ ++lp lcl|FitnessBrowser__pseudo3_N2E3:AO353_07155 324 NLNILFGLDERLGLSHAGMLP 344 ****************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.17 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory