Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate AO353_26890 AO353_26890 aspartate aminotransferase
Query= BRENDA::Q56232 (385 letters) >FitnessBrowser__pseudo3_N2E3:AO353_26890 Length = 395 Score = 252 bits (643), Expect = 1e-71 Identities = 143/365 (39%), Positives = 210/365 (57%), Gaps = 9/365 (2%) Query: 19 VNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALA 78 ++ +ALELR QGVD++ L+ G+PDFDTP+ + +AA +L G T Y+ G LR ++A Sbjct: 20 IHYRALELREQGVDVLLLSVGDPDFDTPKPIVQAAIDSLLAGDTHYSEVRGTRSLRTSIA 79 Query: 79 EKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGV 138 + R +G V + +V G + A++++ Q +LDPGDEV+V P +V+Y + G Sbjct: 80 RRHTRRSGQVVDADHVLVLPGAQCAVYSVVQCLLDPGDEVLVAEPMYVTYEGVFGACGAK 139 Query: 139 VVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDF 198 VV + PE GF DP + ITPRT+A+++NSPNNP+GA + +ALARL V+HD Sbjct: 140 VVPIAVRPENGFRVDPTDIAARITPRTRAILLNSPNNPSGASLSLAIWQALARLCVKHDL 199 Query: 199 YLVSDEIYEHLLYEGEHFSPGRV--APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAM 256 +L+SDE+Y LLYEGEH SP + E T TVN +K+ AMTGWR+G+ GPK + + + Sbjct: 200 WLISDEVYSELLYEGEHISPASLPGMAERTATVNSLSKSHAMTGWRVGWVIGPKRLTEHL 259 Query: 257 ASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGL-TALGLKAV 315 ++S Q A AL EA + + R YR RRDL+ L G+ V Sbjct: 260 ENLSLCMLFGIPDFVQNAARVAL---EADLPELALMRNEYRARRDLVCARLGDCPGISPV 316 Query: 316 RPSGAFYVLMDTSPIAPDEVRAAERLLEA-GVAVVPGTDF--AAFGHVRLSYATSEENLR 372 P G +V++D AE+LLE V+V+ G F +A GH+R+ ++ L Sbjct: 317 IPDGGMFVMVDVRQTGVGAQAFAEKLLEGYAVSVLAGEAFGPSAAGHIRIGLVLDQQRLA 376 Query: 373 KALER 377 +A R Sbjct: 377 EACRR 381 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 395 Length adjustment: 31 Effective length of query: 354 Effective length of database: 364 Effective search space: 128856 Effective search space used: 128856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory