Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate AO356_13080 AO356_13080 acetylornithine deacetylase
Query= ecocyc::ACETYLORNDEACET-MONOMER (383 letters) >lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 AO356_13080 acetylornithine deacetylase Length = 385 Score = 362 bits (930), Expect = e-105 Identities = 190/379 (50%), Positives = 247/379 (65%), Gaps = 5/379 (1%) Query: 5 LPPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPV-PGTRNKFN 63 LP + + ALIATPS+S T+ LDQSN+ +I LLA W +LGF+ +VQ V PG KFN Sbjct: 3 LPSMKDQFAALIATPSVSCTQPGLDQSNSAVIELLAGWLTELGFSCDVQQVSPG---KFN 59 Query: 64 MLASIGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDA 123 +LAS G G GGL+LAGH+DTVPFD W DP LTE DG+ GLG+ DMKGFFA ++A Sbjct: 60 LLASFGSGPGGLVLAGHSDTVPFDGALWQTDPLKLTEVDGRWVGLGSCDMKGFFALAIEA 119 Query: 124 LRDVDVTKLKKPLYILATADEETSMAGARYFAETTALRPDCAIIGEPTSLQPVRAHKGHI 183 ++ + K+PL ILAT DEE+SMAGAR A+ A+IGEPT L+P+R HKG + Sbjct: 120 VKPLLDQPFKQPLLILATCDEESSMAGARALADAGRPLGRAAVIGEPTGLRPIRLHKGVM 179 Query: 184 SNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLNLGH 243 I I G+SGHSSDP+ G +A+E MHDA+G + LR + + F+VP PTLN G Sbjct: 180 MERIDILGRSGHSSDPSLGRSALEAMHDAMGELRGLRLQWQREFRNPQFSVPQPTLNFGC 239 Query: 244 IHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELHPPIP 303 IHGGD NRIC C + D+RPLPGM L + L P++ER ++ L P +P Sbjct: 240 IHGGDNPNRICGQCSMEFDLRPLPGMDPQVLRAAIRQKLEPIAERHQVKIDYAPLFPEVP 299 Query: 304 GYECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPDEYLE 362 +E + +LV V E+L G + E V + TEAP++Q L C TLVLGPG I AHQP EYLE Sbjct: 300 PFEQAEDAELVRVAERLTGHRAEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLE 359 Query: 363 TRFIKPTRELITQVIHHFC 381 ++PT +L+ Q+I H+C Sbjct: 360 MSRLQPTVQLLRQLIGHYC 378 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 385 Length adjustment: 30 Effective length of query: 353 Effective length of database: 355 Effective search space: 125315 Effective search space used: 125315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate AO356_13080 AO356_13080 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.18840.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-123 397.5 0.0 3.1e-123 397.4 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 AO356_13080 acetylornithine deac Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 AO356_13080 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.4 0.0 3.1e-123 3.1e-123 3 365 .] 10 374 .. 8 374 .. 0.98 Alignments for each domain: == domain 1 score: 397.4 bits; conditional E-value: 3.1e-123 TIGR01892 3 lakLvafdsvsar......snvdlieyvedyleelgvavevlpvadgaeksnllaviGpkega 59 +a+L+a++svs + sn ++ie+++++l elg++ +v++v g k+nlla+ G +g lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 10 FAALIATPSVSCTqpgldqSNSAVIELLAGWLTELGFSCDVQQVSPG--KFNLLASFG--SGP 68 789*********99********************************9..*********..999 PP TIGR01892 60 gglvlsGhtDvvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkP 122 gglvl+Gh+D+vP+d+a W +Dp++Lte dgr g+G++DmkGF+al+++av+ l ++ k+P lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 69 GGLVLAGHSDTVPFDGALWQTDPLKLTEVDGRWVGLGSCDMKGFFALAIEAVKPLLDQPFKQP 131 *************************************************************** PP TIGR01892 123 lhlvlsaDeevglaGakkliealarrpalaivGePtslvavRahkGkasakvtvrGreghssr 185 l ++++ Dee ++aGa+ l++a+ + + a++GePt+l+++R hkG + ++ + Gr+ghss+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 132 LLILATCDEESSMAGARALADAGRPLGRAAVIGEPTGLRPIRLHKGVMMERIDILGRSGHSSD 194 *************************************************************** PP TIGR01892 186 pdrGvsaielaakllarlvaladklkredleeaFtppyatlniGtvkGGkavniiaaaCelvl 248 p G sa e +++++++l +l+ + +re + F +p +tln G ++GG+ n+i+++C +++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 195 PSLGRSALEAMHDAMGELRGLRLQWQREFRNPQFSVPQPTLNFGCIHGGDNPNRICGQCSMEF 257 *************************************************************** PP TIGR01892 249 elRpipGmdpeellallekiaeevkekapgfevkveelsatpaleleedaelvalleklaGaa 311 +lRp+pGmdp+ l a +++ +e++ e++ + + + p +e edaelv+++e+l+G++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 258 DLRPLPGMDPQVLRAAIRQKLEPIAERHQVKIDYAPLFPEVPPFEQAEDAELVRVAERLTGHR 320 ************************88888777788889999********************** PP TIGR01892 312 aevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrallerlv 365 ae+v++gtea++lq+lG+e++vlGPGdi ahqp+eY+e++ l+++ +ll++l+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13080 321 AEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLEMSRLQPTVQLLRQLI 374 **************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (385 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.08 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory