Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate AO356_07485 AO356_07485 carbamoyl phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_07485 Length = 378 Score = 538 bits (1387), Expect = e-158 Identities = 264/378 (69%), Positives = 302/378 (79%) Query: 1 MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHI 60 + K A+L L DG+ F G AIGA G VGEVVFNT+MTGYQEILTDPSY++QIVTLTYPHI Sbjct: 1 LTKPAILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHI 60 Query: 61 GNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTR 120 GN GT D ES +V + GLVIRDLPL+ASN+RNT LS YLK +N+VAIA IDTR+LTR Sbjct: 61 GNTGTTPEDAESDRVWSAGLVIRDLPLVASNWRNTMSLSDYLKANNVVAIAGIDTRRLTR 120 Query: 121 LLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGG 180 +LREKGAQNGCI+AGDN A+ A+ FPGL GMDLAK V+T + Y W W L Sbjct: 121 ILREKGAQNGCIMAGDNISEEAAIAAAQGFPGLKGMDLAKVVSTQKQYEWRSTVWDLKTD 180 Query: 181 LPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSN 240 + ELP+HVVAYD+G K NILRMLV+RGCR+T+VPAQT A DVL + PDG+FLSN Sbjct: 181 SHATIEASELPYHVVAYDYGVKLNILRMLVERGCRVTVVPAQTPAADVLALKPDGVFLSN 240 Query: 241 GPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDV 300 GPGDP PCDYAI AI+ LET+IPVFGICLGHQLLALASGAKT+KM GHHG NHPV+D+ Sbjct: 241 GPGDPEPCDYAIQAIKDVLETEIPVFGICLGHQLLALASGAKTLKMGHGHHGANHPVQDL 300 Query: 301 EKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGP 360 + VVMIT+QNHGFAVDEATLPAN+R HKSLFDGTLQGI RTDK AFSFQGHPEASPGP Sbjct: 301 DTGVVMITSQNHGFAVDEATLPANVRAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGP 360 Query: 361 HDAAPLFDHFIELIEQYR 378 +D APLFD FI + + R Sbjct: 361 NDVAPLFDRFINEMAKRR 378 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 378 Length adjustment: 30 Effective length of query: 352 Effective length of database: 348 Effective search space: 122496 Effective search space used: 122496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AO356_07485 AO356_07485 (carbamoyl phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.705.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-148 478.5 0.0 7e-148 478.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 AO356_07485 carbamoyl phosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 AO356_07485 carbamoyl phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 478.3 0.0 7e-148 7e-148 1 360 [. 5 375 .. 5 376 .. 0.95 Alignments for each domain: == domain 1 score: 478.3 bits; conditional E-value: 7e-148 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvne 63 a+l+l+dG++f+g+++ga++++vGevvFnT+mtGYqEiltDpsY++qiv+ltyp+ign+g+++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 5 AILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHIGNTGTTP 67 689************************************************************ PP TIGR01368 64 edaeskkikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmka 126 edaes++++ +glv+++l +sn+r++ sL+++lk +++vai+g+DTR l++ lRekg++++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 68 EDAESDRVWSAGLVIRDLPLVASNWRNTMSLSDYLKANNVVAIAGIDTRRLTRILREKGAQNG 130 *************************************************************** PP TIGR01368 127 vistekse.keelvekakespkvkevnlvkevstkeayeleq.........k..akkegkklr 177 +i++ ++ +e ++++a+ p +k+++l+k vst+++ye+++ + +++++ ++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 131 CIMAGDNIsEEAAIAAAQGFPGLKGMDLAKVVSTQKQYEWRStvwdlktdsHatIEASELPYH 193 **99875526777888999**********************977777655414345555559* PP TIGR01368 178 vvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvk 240 vv++d+GvK nilr+Lv+rg++vtvvpa+t+a+++ +l+pdg++lsnGPGdP+ +++ai+ +k lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 194 VVAYDYGVKLNILRMLVERGCRVTVVPAQTPAADVLALKPDGVFLSNGPGDPEPCDYAIQAIK 256 *************************************************************** PP TIGR01368 241 klleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdee 303 +le++iP+fGIclGhqllala+gakt+k+ Gh+GaNhpv+dl+tg v+itsqNHg+avde+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 257 DVLETEIPVFGICLGHQLLALASGAKTLKMGHGHHGANHPVQDLDTGVVMITSQNHGFAVDEA 319 *************************************************************** PP TIGR01368 304 slkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 +l+++ +++ h++l+Dgt++g+e++++ +fs Q HPeaspGp+d + lFd+f+++++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 320 TLPAN-VRAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGPNDVAPLFDRFINEMA 375 *8866.************************************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (378 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.40 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory