Align Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 (characterized)
to candidate AO356_07485 AO356_07485 carbamoyl phosphate synthase small subunit
Query= SwissProt::Q9LVW7 (430 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_07485 Length = 378 Score = 338 bits (866), Expect = 2e-97 Identities = 174/376 (46%), Positives = 241/376 (64%), Gaps = 11/376 (2%) Query: 58 ARLVLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNTG 117 A L L DGSI+ ++ GA G + E+VFNT++TGYQEILTDPSYA Q V +T P IGNTG Sbjct: 5 AILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHIGNTG 64 Query: 118 VNPDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLRE 177 P+D ES + + GLVIR+L + SNWR T +L+DYL +++ + +DTR +TR LRE Sbjct: 65 TTPEDAESDRVWSAGLVIRDLPLVASNWRNTMSLSDYLKANNVVAIAGIDTRRLTRILRE 124 Query: 178 DGSLIGVLSTEQSKTDDELLQMSRSW-DIVGIDLISDVSCKSPYEWVDKTNAEWDFNTNS 236 G+ G + + +++ + ++ + + G+DL VS + YEW + WD T+S Sbjct: 125 KGAQNGCIMAGDNISEEAAIAAAQGFPGLKGMDLAKVVSTQKQYEW---RSTVWDLKTDS 181 Query: 237 R-----DGKSYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNG 291 Y V+AYD+G+K NILR L GC++TVVP+ PAA+ L + PDG+ SNG Sbjct: 182 HATIEASELPYHVVAYDYGVKLNILRMLVERGCRVTVVPAQTPAADVLALKPDGVFLSNG 241 Query: 292 PGDPSAVPYAVETVKELL-GKVPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNR 350 PGDP YA++ +K++L ++PV+GIC+GHQLL A G KT KM GHHG NHPV++ Sbjct: 242 PGDPEPCDYAIQAIKDVLETEIPVFGICLGHQLLALASGAKTLKMGHGHHGANHPVQDLD 301 Query: 351 TGQVEISAQNHNYAVDPASLPGGVEVTHVNLNDGSCAGLSFPEMNVMSLQYHPEASPGPH 410 TG V I++QNH +AVD A+LP V H +L DG+ G+ + + S Q HPEASPGP+ Sbjct: 302 TGVVMITSQNHGFAVDEATLPANVRAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGPN 361 Query: 411 DSDNAFREFI-ELMKR 425 D F FI E+ KR Sbjct: 362 DVAPLFDRFINEMAKR 377 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 378 Length adjustment: 31 Effective length of query: 399 Effective length of database: 347 Effective search space: 138453 Effective search space used: 138453 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate AO356_07485 AO356_07485 (carbamoyl phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.24037.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-148 478.5 0.0 7e-148 478.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 AO356_07485 carbamoyl phosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 AO356_07485 carbamoyl phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 478.3 0.0 7e-148 7e-148 1 360 [. 5 375 .. 5 376 .. 0.95 Alignments for each domain: == domain 1 score: 478.3 bits; conditional E-value: 7e-148 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvne 63 a+l+l+dG++f+g+++ga++++vGevvFnT+mtGYqEiltDpsY++qiv+ltyp+ign+g+++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 5 AILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHIGNTGTTP 67 689************************************************************ PP TIGR01368 64 edaeskkikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmka 126 edaes++++ +glv+++l +sn+r++ sL+++lk +++vai+g+DTR l++ lRekg++++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 68 EDAESDRVWSAGLVIRDLPLVASNWRNTMSLSDYLKANNVVAIAGIDTRRLTRILREKGAQNG 130 *************************************************************** PP TIGR01368 127 vistekse.keelvekakespkvkevnlvkevstkeayeleq.........k..akkegkklr 177 +i++ ++ +e ++++a+ p +k+++l+k vst+++ye+++ + +++++ ++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 131 CIMAGDNIsEEAAIAAAQGFPGLKGMDLAKVVSTQKQYEWRStvwdlktdsHatIEASELPYH 193 **99875526777888999**********************977777655414345555559* PP TIGR01368 178 vvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvk 240 vv++d+GvK nilr+Lv+rg++vtvvpa+t+a+++ +l+pdg++lsnGPGdP+ +++ai+ +k lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 194 VVAYDYGVKLNILRMLVERGCRVTVVPAQTPAADVLALKPDGVFLSNGPGDPEPCDYAIQAIK 256 *************************************************************** PP TIGR01368 241 klleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdee 303 +le++iP+fGIclGhqllala+gakt+k+ Gh+GaNhpv+dl+tg v+itsqNHg+avde+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 257 DVLETEIPVFGICLGHQLLALASGAKTLKMGHGHHGANHPVQDLDTGVVMITSQNHGFAVDEA 319 *************************************************************** PP TIGR01368 304 slkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 +l+++ +++ h++l+Dgt++g+e++++ +fs Q HPeaspGp+d + lFd+f+++++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07485 320 TLPAN-VRAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGPNDVAPLFDRFINEMA 375 *8866.************************************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (378 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.43 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory