Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate AO356_28790 AO356_28790 cysteine synthase
Query= metacyc::MONOMER-20568 (299 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28790 Length = 347 Score = 145 bits (366), Expect = 1e-39 Identities = 102/314 (32%), Positives = 159/314 (50%), Gaps = 20/314 (6%) Query: 1 MIYDNILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKL 60 MI + + + IGNTP++ I+ P+ ++ K+E NP GS+KDR+A M+ A G+L Sbjct: 1 MILNKVSDLIGNTPMLGIDI--PDTHARLLLKIEKNNPGGSIKDRMARNMVLAALKSGRL 58 Query: 61 HPGSTIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILT----- 115 PG ++E++SGNTGIGLAM G + I V+ + ++ ++KA GA++ Sbjct: 59 KPGGVVVESSSGNTGIGLAMAAVEFGLHFIAVVDHHAAQDKIAVMKALGADVRFVAGHYR 118 Query: 116 DKKLGTDGAIRKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVA 175 + ++ R AEL ++ PG F NQ N N Y E AQ +G V +V Sbjct: 119 EDEVAVVERQRMAAELAQQIPGAVF-MNQSDNAAN-AGGYSDFVRETIAQVEGKVGAYVG 176 Query: 176 AVGTSGTLMGVGKNLREKNPEIKIIEAQPTK----GH-----YIQGLKSMEEAIVPAIYQ 226 VGT G++ G+ + L+ NP+ + +P GH Y G + V + Sbjct: 177 CVGTGGSMTGIARGLKLHNPDTVTVAVEPAGSIVFGHPGYPYYQSGTGTPAGDTVGLVLD 236 Query: 227 ADKIDEHILIESEEAFAKAREIVAQEGIFIGMSSGAAMLAAQKLAEK-IDSGVIVVLFAD 285 ID + + +AF AR I G+ +G S+G A+ A + K + +G +VV AD Sbjct: 237 YSCIDLGVQVTDSQAFETARYIARNLGLLVGGSTGGAIFKALEFIHKGVLTGNVVVPIAD 296 Query: 286 RGEKYLSTKLFDTE 299 GEKYL T +FD + Sbjct: 297 GGEKYLHT-VFDDQ 309 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 347 Length adjustment: 28 Effective length of query: 271 Effective length of database: 319 Effective search space: 86449 Effective search space used: 86449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory