GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cysE in Pseudomonas fluorescens FW300-N2C3

Align Serine acetyltransferase; SAT; EC 2.3.1.30 (characterized)
to candidate AO356_06655 AO356_06655 serine acetyltransferase

Query= SwissProt::Q06750
         (217 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06655 AO356_06655 serine
           acetyltransferase
          Length = 258

 Score =  225 bits (573), Expect = 7e-64
 Identities = 113/219 (51%), Positives = 151/219 (68%), Gaps = 13/219 (5%)

Query: 3   FRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHALYKRKFYFLARLISQVSR 62
           F  L+EDI +VF +DPAAR+ FEV+  Y G+HAIW HR++ AL+   + +LARL+S   R
Sbjct: 2   FERLREDIQSVFHRDPAARNAFEVLTCYPGMHAIWIHRLSGALWNMGWKWLARLVSNFGR 61

Query: 63  FFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEKGKRHPTIK 122
           + TGIEIHPGA +GRRFFIDHGMG+VIGET EIG++VT++QGVTLGGT   KGKRHPT++
Sbjct: 62  WLTGIEIHPGAKVGRRFFIDHGMGIVIGETAEIGDDVTLYQGVTLGGTSWNKGKRHPTLE 121

Query: 123 DDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVGIPGRVVVQNGKK--VRRDL 180
           D  ++  GAKVLG  TVG G+K+G+ +VV   VP  +TVVGIPGR++V++ ++   RR  
Sbjct: 122 DGVVVGAGAKVLGPFTVGAGAKVGSNAVVTKAVPPGATVVGIPGRIIVKSDEEQDARRKA 181

Query: 181 N-----------HQDLPDPVADRFKSLEQQILELKAELE 208
                        +D+PDPVA     L   +  +   LE
Sbjct: 182 MAEKIGFDAYGVGEDMPDPVARAINQLLDHLQAVDGRLE 220


Lambda     K      H
   0.323    0.141    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 245
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 217
Length of database: 258
Length adjustment: 23
Effective length of query: 194
Effective length of database: 235
Effective search space:    45590
Effective search space used:    45590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 46 (22.3 bits)

Align candidate AO356_06655 AO356_06655 (serine acetyltransferase)
to HMM TIGR01172 (cysE: serine O-acetyltransferase (EC 2.3.1.30))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01172.hmm
# target sequence database:        /tmp/gapView.6842.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01172  [M=162]
Accession:   TIGR01172
Description: cysE: serine O-acetyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
    2.1e-81  257.8   0.2    2.7e-81  257.4   0.2    1.1  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06655  AO356_06655 serine acetyltransfe


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06655  AO356_06655 serine acetyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  257.4   0.2   2.7e-81   2.7e-81       2     162 .]       6     166 ..       5     166 .. 0.99

  Alignments for each domain:
  == domain 1  score: 257.4 bits;  conditional E-value: 2.7e-81
                                       TIGR01172   2 kedlkavlerDPaaesalevlllykglhallayrlahalykrklkllarllselvrvltgvdi 64 
                                                     +ed+++v++rDPaa++a+evl +y+g+ha++++rl+ al++ ++k+larl+s++ r+ltg++i
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06655   6 REDIQSVFHRDPAARNAFEVLTCYPGMHAIWIHRLSGALWNMGWKWLARLVSNFGRWLTGIEI 68 
                                                     79************************************************************* PP

                                       TIGR01172  65 hPaakigrgvliDhatGvviGetavigddvsiyqgvtLGgtgkekgkRhPtvkegvvigagak 127
                                                     hP+ak+gr+++iDh++G+viGeta+igddv++yqgvtLGgt+++kgkRhPt+++gvv+gagak
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06655  69 HPGAKVGRRFFIDHGMGIVIGETAEIGDDVTLYQGVTLGGTSWNKGKRHPTLEDGVVVGAGAK 131
                                                     *************************************************************** PP

                                       TIGR01172 128 vLGnievgenakiGansvvlkdvpaeatvvGvpar 162
                                                     vLG+++vg++ak+G+n+vv+k vp++atvvG+p+r
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06655 132 VLGPFTVGAGAKVGSNAVVTKAVPPGATVVGIPGR 166
                                                     *********************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (162 nodes)
Target sequences:                          1  (258 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 6.48
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory