GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisD in Pseudomonas fluorescens FW300-N2C3

Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate AO356_06965 AO356_06965 histidinol dehydrogenase

Query= BRENDA::Q8G2R2
         (430 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965 AO356_06965
           histidinol dehydrogenase
          Length = 445

 Score =  390 bits (1003), Expect = e-113
 Identities = 206/428 (48%), Positives = 279/428 (65%), Gaps = 1/428 (0%)

Query: 2   VTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRIDL 61
           +  L   DPDF       LS +    + V++ V +I+  VR  GD+AL++++++FD + +
Sbjct: 7   IRRLNAADPDFAHHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVEFTQKFDGLQV 66

Query: 62  EKTGIAVTEAE-IDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSR 120
                 +   E ++ A         EAL+ A  R+  +H RQ      YT+A G  LG +
Sbjct: 67  ASMADLILPRERLELALTRITVPQREALEKAASRVRDYHERQKQDSWSYTEADGTVLGQK 126

Query: 121 WTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAG 180
            T ++  GLYVPGG ASYPSSVLMNA+PAKVAGV  +VMVVP P G +N LVL AA +AG
Sbjct: 127 VTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEINELVLAAACIAG 186

Query: 181 VSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVL 240
           V  ++ +GGAQA+AALAYGTE++  V K+VGPGN YVA AKR VFG VGIDMIAGPSE+L
Sbjct: 187 VDRVFTIGGAQAVAALAYGTESVPRVDKVVGPGNIYVATAKRHVFGQVGIDMIAGPSEIL 246

Query: 241 IVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTETASA 300
           +V D   +PDWIA DL +QAEHD  AQ+IL++ D  F   V  ++++ L T+ R E  + 
Sbjct: 247 VVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIDKLLPTMDRAEIINT 306

Query: 301 SWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIG 360
           S    GA+I V D   AI +ANRIA EHLE++VAD +A++P+IR+AG+IF+G +T E +G
Sbjct: 307 SINGRGALIKVDDMAQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRHTSEALG 366

Query: 361 DYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAH 420
           DY  G NHVLPT+ +ARFSS L V D+ KR+S++    +    LG  A  +AR E L AH
Sbjct: 367 DYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGKTASVLARGESLSAH 426

Query: 421 AQSVAIRL 428
           A+S   R+
Sbjct: 427 ARSAEYRI 434


Lambda     K      H
   0.318    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 493
Number of extensions: 29
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 430
Length of database: 445
Length adjustment: 32
Effective length of query: 398
Effective length of database: 413
Effective search space:   164374
Effective search space used:   164374
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate AO356_06965 AO356_06965 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00069.hmm
# target sequence database:        /tmp/gapView.29529.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00069  [M=393]
Accession:   TIGR00069
Description: hisD: histidinol dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   1.7e-165  537.0   0.1   1.9e-165  536.8   0.1    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965  AO356_06965 histidinol dehydroge


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965  AO356_06965 histidinol dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  536.8   0.1  1.9e-165  1.9e-165       1     393 []      39     433 ..      39     433 .. 0.99

  Alignments for each domain:
  == domain 1  score: 536.8 bits;  conditional E-value: 1.9e-165
                                       TIGR00069   1 vkeiiedvrkeGdeAlleytekfdkv...kleslrvseeeleealeavdeelkealelaaeni 60 
                                                     v +ii++vr++Gd+Al+e+t+kfd++   ++++l +++e+le al++++   +eale+aa+++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965  39 VLDIIKAVRERGDAALVEFTQKFDGLqvaSMADLILPRERLELALTRITVPQREALEKAASRV 101
                                                     679*********************99556677889**************************** PP

                                       TIGR00069  61 ekfhekqlpesveveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeiv 123
                                                     +++he+q+++s+++++++g++lgqkv+pl+r+glYvPgGka+ypS+vlm+a+pAkvAgv+e+v
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965 102 RDYHERQKQDSWSYTEADGTVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVV 164
                                                     *************************************************************** PP

                                       TIGR00069 124 vvtPpkkdgkvnpavlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaA 186
                                                     +v P+  +g++n+ vlaaa ++gvd+v+++GGaqa+aalayGte+vp+vdk+vGPGniyV++A
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965 165 MVVPTP-RGEINELVLAAACIAGVDRVFTIGGAQAVAALAYGTESVPRVDKVVGPGNIYVATA 226
                                                     *****6.9******************************************************* PP

                                       TIGR00069 187 KklvfgevgidmiaGPsEvlviadesanpelvaaDllsqaEHdedaqailvttseelaekvee 249
                                                     K++vfg+vgidmiaGPsE+lv++d +++p+++a+Dl+sqaEHdedaqailv++++e+++kv +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965 227 KRHVFGQVGIDMIAGPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAA 289
                                                     *************************************************************** PP

                                       TIGR00069 250 eveeqleelerkeiaekslekngaiilvddleealelsneyApEHLelqtkdpeellkkikna 312
                                                     ++++ l +++r+ei+++s++ +ga+i vdd+++a+e++n++ApEHLel ++dp+++l++i++a
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965 290 SIDKLLPTMDRAEIINTSINGRGALIKVDDMAQAIEVANRIAPEHLELSVADPQAWLPQIRHA 352
                                                     *************************************************************** PP

                                       TIGR00069 313 GsvflGeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqelskealeelaeave 375
                                                     G++f+G++t+ealgdy+aGpnhvLPTsgtArf+s+l+v+dF+kr+s++ +s+++++el+++++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965 353 GAIFMGRHTSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGKTAS 415
                                                     *************************************************************** PP

                                       TIGR00069 376 klaeaEgLeaHaeavevR 393
                                                      la+ E L+aHa+++e R
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_06965 416 VLARGESLSAHARSAEYR 433
                                                     **************9988 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (393 nodes)
Target sequences:                          1  (445 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.38
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory