GapMind for Amino acid biosynthesis

 

Aligments for a candidate for prs in Pseudomonas fluorescens FW300-N2C3

Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate AO356_16465 AO356_16465 ribose-phosphate pyrophosphokinase

Query= BRENDA::P0A717
         (315 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465 AO356_16465
           ribose-phosphate pyrophosphokinase
          Length = 313

 Score =  424 bits (1091), Expect = e-123
 Identities = 209/310 (67%), Positives = 257/310 (82%), Gaps = 1/310 (0%)

Query: 4   MKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPT 63
           M +F GNA P+LA+R+  +L+  LGD +VG+FSDGE++ +INENVRG D+FIIQ TCAPT
Sbjct: 4   MMVFTGNANPDLARRVVRQLHIPLGDISVGKFSDGEITAEINENVRGKDVFIIQPTCAPT 63

Query: 64  NDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVD 123
           NDNLMELVVM DA RR+SA RITAVIPYFGYARQDRR RSARV I+AKVVAD L+ VG+D
Sbjct: 64  NDNLMELVVMADAFRRSSATRITAVIPYFGYARQDRRPRSARVAISAKVVADMLTVVGID 123

Query: 124 RVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAKL 183
           RVLTVDLHA+QIQGFFD+PVDN++GSP+L++D+     +N ++VSPDIGGVVRARA+AK 
Sbjct: 124 RVLTVDLHADQIQGFFDIPVDNIYGSPVLVDDIEDQRFENLMIVSPDIGGVVRARAVAKS 183

Query: 184 LNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKR 243
           L   D+ IIDKRR +AN S+VMHIIGDV GR C+LVDDM+DT GTLC AA+ALKE GA +
Sbjct: 184 LG-VDLGIIDKRREKANHSEVMHIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAK 242

Query: 244 VFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRI 303
           VFAY THP+ SG A  N+ NSV+DE+VV +TIPLS   ++   +R L ++ ++AEA+RRI
Sbjct: 243 VFAYCTHPVLSGRAIENIENSVLDELVVTNTIPLSAAAQACARIRQLDIAPVVAEAVRRI 302

Query: 304 SNEESISAMF 313
           SNEESISAMF
Sbjct: 303 SNEESISAMF 312


Lambda     K      H
   0.321    0.137    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 359
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 315
Length of database: 313
Length adjustment: 27
Effective length of query: 288
Effective length of database: 286
Effective search space:    82368
Effective search space used:    82368
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate AO356_16465 AO356_16465 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01251.hmm
# target sequence database:        /tmp/gapView.22485.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01251  [M=309]
Accession:   TIGR01251
Description: ribP_PPkin: ribose-phosphate diphosphokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   9.5e-127  408.1   2.8   1.1e-126  407.9   2.8    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465  AO356_16465 ribose-phosphate pyr


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465  AO356_16465 ribose-phosphate pyrophosphokinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  407.9   2.8  1.1e-126  1.1e-126       1     309 []       4     313 .]       4     313 .] 0.98

  Alignments for each domain:
  == domain 1  score: 407.9 bits;  conditional E-value: 1.1e-126
                                       TIGR01251   1 lkilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvnd 63 
                                                     ++++ g+++++la++v ++l+++lgd++v kF+dgE+  +i+e+vrgkdvfii q t+ap+nd
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465   4 MMVFTGNANPDLARRVVRQLHIPLGDISVGKFSDGEITAEINENVRGKDVFII-QPTCAPTND 65 
                                                     799**************************************************.********* PP

                                       TIGR01251  64 almellllidalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltv 125
                                                     +lmel++++da++r+sa ++taviPy+gYaRqd++ +  r +isak+va++l+ +G+drvltv
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465  66 NLMELVVMADAFRRSSATRITAVIPYFGYARQDRRPRsARVAISAKVVADMLTVVGIDRVLTV 128
                                                     **********************************97758************************ PP

                                       TIGR01251 126 dlHseqiqgfFdvpvenlsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaii 188
                                                     dlH++qiqgfFd+pv+n+++sp+l+++++++  +nl++vsPD G+v ra++vak+lg++l ii
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465 129 DLHADQIQGFFDIPVDNIYGSPVLVDDIEDQRFENLMIVSPDIGGVVRARAVAKSLGVDLGII 191
                                                     *************************************************************** PP

                                       TIGR01251 189 eKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfs 251
                                                     +K+R+ k+n+ ev++++gdveg+++++vDD+++T+gTl++aa++Lke+GA kv++++th+v+s
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465 192 DKRRE-KANHSEVMHIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHGAAKVFAYCTHPVLS 253
                                                     *****.899****************************************************** PP

                                       TIGR01251 252 gdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeaiarihenesvsslfd 309
                                                     g+A+e++++++++e++vtnti+     +++ +++++++ap++aea++ri+++es+s++f+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16465 254 GRAIENIENSVLDELVVTNTIPLsAAaQACARIRQLDIAPVVAEAVRRISNEESISAMFR 313
                                                     ***********************65579******************************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (309 nodes)
Target sequences:                          1  (313 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01
# Mc/sec: 9.25
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory