GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvH in Pseudomonas fluorescens FW300-N2C3

Align acetolactate synthase (subunit 2/2) (EC 2.2.1.6) (characterized)
to candidate AO356_16170 AO356_16170 acetolactate synthase 3 catalytic subunit

Query= BRENDA::P00893
         (574 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 AO356_16170
           acetolactate synthase 3 catalytic subunit
          Length = 574

 Score =  758 bits (1958), Expect = 0.0
 Identities = 365/576 (63%), Positives = 448/576 (77%), Gaps = 4/576 (0%)

Query: 1   MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADG 60
           +E+LSG EM+VR L D+GVK ++GYPGGA+L +YDAL     + H+LVRHEQAA HMADG
Sbjct: 1   VELLSGGEMLVRFLRDEGVKYIYGYPGGALLHVYDALFKEPEVTHILVRHEQAATHMADG 60

Query: 61  LARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVG 120
            ARATG+ GVVLVTSGPGATNAITGIATAYMDSIP+V++SGQV ++++G DAFQE DM+G
Sbjct: 61  YARATGKAGVVLVTSGPGATNAITGIATAYMDSIPMVIISGQVPSTMVGTDAFQETDMIG 120

Query: 121 ISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNPANKLPYVWPESV 180
           ISRP+VKHSF++K   +IP+V+KKAF+LA SGRPGPVVVD+PKD+ NPA K  Y++P+  
Sbjct: 121 ISRPIVKHSFMIKHASEIPEVMKKAFYLAESGRPGPVVVDVPKDMTNPAEKFEYIFPKKA 180

Query: 181 SMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGCHQQLKETVEALNLPVVCS 240
            +RSY+P   GH GQI++A + L+AAK+PV+Y GGG I  G    L E  + LNLPV  +
Sbjct: 181 KLRSYSPAVRGHSGQIRKAAEMLLAAKRPVLYSGGGVILGGGSAPLTELAKMLNLPVTNT 240

Query: 241 LMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATV 300
           LMGLGAFP T RQ +GMLGMHG+Y AN+ MH+ADVI AVG RFDDR  N  AK+CPNA +
Sbjct: 241 LMGLGAFPGTDRQFIGMLGMHGSYTANLAMHHADVILAVGARFDDRVINGPAKFCPNAKI 300

Query: 301 LHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESAHQPLDEIRDWWQQIEQWRA- 359
           +HIDIDP SISKT+ AD+PIVG    VL +M+ +L +       + +  WW+Q+++WR  
Sbjct: 301 IHIDIDPASISKTIKADVPIVGPVESVLTEMVAILKEIGEVPNKESVASWWKQVDEWRGD 360

Query: 360 RQCLKYDT-HSEKIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSG 418
           R    YD      IKPQ VIETL  +TKGDA+VTSDVGQHQMFAA YY FDKP RWINSG
Sbjct: 361 RGLFPYDKGDGSVIKPQTVIETLCEVTKGDAFVTSDVGQHQMFAAQYYKFDKPNRWINSG 420

Query: 419 GLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQELSTALQYELPVLVVNLNNRYL 478
           GLGTMGFG PAA+G+K++ P+  V CVTG+GSIQMNIQELST LQY LPV +V LNN  L
Sbjct: 421 GLGTMGFGFPAAMGIKLSFPDADVACVTGEGSIQMNIQELSTCLQYGLPVKIVILNNGVL 480

Query: 479 GMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQISHPHELESKLSEALEQVRNN 538
           GMV+QWQDM Y  RHS SYM+SLPDFV+LAEAYGHVG++I+   +L+SK+ EA      +
Sbjct: 481 GMVRQWQDMSYGSRHSHSYMESLPDFVKLAEAYGHVGVRITESKDLKSKMEEAF--AMKD 538

Query: 539 RLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT 574
           RLV +D+ VD SEHVYPMQI+ G M +MWLSKTERT
Sbjct: 539 RLVVIDIAVDTSEHVYPMQIKDGSMRDMWLSKTERT 574


Lambda     K      H
   0.319    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1028
Number of extensions: 32
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 574
Length of database: 574
Length adjustment: 36
Effective length of query: 538
Effective length of database: 538
Effective search space:   289444
Effective search space used:   289444
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

Align candidate AO356_16170 AO356_16170 (acetolactate synthase 3 catalytic subunit)
to HMM TIGR00118 (ilvB: acetolactate synthase, large subunit, biosynthetic type (EC 2.2.1.6))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00118.hmm
# target sequence database:        /tmp/gapView.6380.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00118  [M=557]
Accession:   TIGR00118
Description: acolac_lg: acetolactate synthase, large subunit, biosynthetic type
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   9.3e-261  852.0   0.9   1.1e-260  851.8   0.9    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170  AO356_16170 acetolactate synthas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170  AO356_16170 acetolactate synthase 3 catalytic subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  851.8   0.9  1.1e-260  1.1e-260       1     556 [.       4     569 ..       4     570 .. 0.97

  Alignments for each domain:
  == domain 1  score: 851.8 bits;  conditional E-value: 1.1e-260
                                       TIGR00118   1 lkgaeilveslkkegvetvfGyPGGavlpiydaly.dselehilvrheqaaahaadGyarasG 62 
                                                     l+g+e+lv+ l++egv++++GyPGGa+l++ydal+ + e++hilvrheqaa+h+adGyara+G
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170   4 LSGGEMLVRFLRDEGVKYIYGYPGGALLHVYDALFkEPEVTHILVRHEQAATHMADGYARATG 66 
                                                     689********************************889************************* PP

                                       TIGR00118  63 kvGvvlatsGPGatnlvtgiatayldsvPlvvltGqvatsliGsdafqeidilGitlpvtkhs 125
                                                     k+Gvvl+tsGPGatn++tgiatay+ds+P+v+++Gqv+++++G+dafqe d++Gi++p++khs
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170  67 KAGVVLVTSGPGATNAITGIATAYMDSIPMVIISGQVPSTMVGTDAFQETDMIGISRPIVKHS 129
                                                     *************************************************************** PP

                                       TIGR00118 126 flvkkaedlpeilkeafeiastGrPGPvlvdlPkdvteaeieleve..ekvelpgykptvkgh 186
                                                     f++k+a+++pe++k+af++a++GrPGPv+vd+Pkd+t+++ ++e+   +k +l++y p v+gh
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 130 FMIKHASEIPEVMKKAFYLAESGRPGPVVVDVPKDMTNPAEKFEYIfpKKAKLRSYSPAVRGH 192
                                                     **************************************9988888777*************** PP

                                       TIGR00118 187 klqikkaleliekakkPvllvGgGviiaeaseelkelaerlkipvtttllGlGafpedhplal 249
                                                       qi+ka+e++ +ak+Pvl+ GgGvi +++s+ l+ela++l++pvt tl+GlGafp ++++++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 193 SGQIRKAAEMLLAAKRPVLYSGGGVILGGGSAPLTELAKMLNLPVTNTLMGLGAFPGTDRQFI 255
                                                     *************************************************************** PP

                                       TIGR00118 250 gmlGmhGtkeanlavseadlliavGarfddrvtgnlakfapeakiihididPaeigknvkvdi 312
                                                     gmlGmhG+++anla+++ad+++avGarfddrv +  akf+p+akiihididPa+i+k++k+d+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 256 GMLGMHGSYTANLAMHHADVILAVGARFDDRVINGPAKFCPNAKIIHIDIDPASISKTIKADV 318
                                                     *************************************************************** PP

                                       TIGR00118 313 pivGdakkvleellkklkee....ekkeke.Wlekieewkkeyilk.ldeeees.ikPqkvik 368
                                                     pivG +++vl+e+++ lke     +k++   W+++++ew+ +  l  +d+ ++s ikPq+vi+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 319 PIVGPVESVLTEMVAILKEIgevpNKESVAsWWKQVDEWRGDRGLFpYDKGDGSvIKPQTVIE 381
                                                     *************999888777764444446*********999877688888777******** PP

                                       TIGR00118 369 elskllkdeaivttdvGqhqmwaaqfyktkkprkfitsgGlGtmGfGlPaalGakvakpeetv 431
                                                     +l++++k++a+vt+dvGqhqm+aaq+yk++kp+++i+sgGlGtmGfG+Paa+G+k++ p+++v
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 382 TLCEVTKGDAFVTSDVGQHQMFAAQYYKFDKPNRWINSGGLGTMGFGFPAAMGIKLSFPDADV 444
                                                     *************************************************************** PP

                                       TIGR00118 432 vavtGdgsfqmnlqelstiveydipvkivilnnellGmvkqWqelfyeerysetklaselpdf 494
                                                      +vtG+gs+qmn+qelst+ +y++pvkivilnn +lGmv+qWq++ y  r+s+++++s lpdf
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 445 ACVTGEGSIQMNIQELSTCLQYGLPVKIVILNNGVLGMVRQWQDMSYGSRHSHSYMES-LPDF 506
                                                     *********************************************************5.**** PP

                                       TIGR00118 495 vklaeayGvkgiriekpeeleeklkealesk.epvlldvevdkeeevlPmvapGagldelvee 556
                                                     vklaeayG++g+ri++ ++l++k++ea+++k ++v++d+ vd++e+v+Pm+++ +++ +++ +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16170 507 VKLAEAYGHVGVRITESKDLKSKMEEAFAMKdRLVVIDIAVDTSEHVYPMQIKDGSMRDMWLS 569
                                                     ***************************9988799**************************976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (557 nodes)
Target sequences:                          1  (574 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.02s 00:00:00.04 Elapsed: 00:00:00.03
# Mc/sec: 9.71
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory