GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvH in Pseudomonas fluorescens FW300-N2C3

Align Probable acetolactate synthase large subunit; AHAS; EC 2.2.1.6; Acetohydroxy-acid synthase large subunit; ALS (uncharacterized)
to candidate AO356_19620 AO356_19620 glyoxylate carboligase

Query= curated2:O08353
         (599 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19620 AO356_19620
           glyoxylate carboligase
          Length = 591

 Score =  321 bits (823), Expect = 5e-92
 Identities = 191/581 (32%), Positives = 314/581 (54%), Gaps = 43/581 (7%)

Query: 1   MNGAEAMIKALEAEKVEILFGYPGGALLPFYDALHH-SDLIHLLTRHEQAAAHAADGYAR 59
           M   EA +  +  E V+  FG PG A+ P Y AL     + H+L RH + A+H A+GY R
Sbjct: 4   MRAIEAAVLVMRREGVDTAFGIPGAAINPLYSALQKVGGIDHVLARHVEGASHMAEGYTR 63

Query: 60  A-SGKVGVCIGTSGPGATNLVTGVATAHSDSSPMVALTGQVPTKLIGNDAFQEIDALGLF 118
             +G +GVCIGTSGP  T++VTG+ +A +DS P++ +TGQ P   +  + FQ +D   + 
Sbjct: 64  TKAGNIGVCIGTSGPAGTDMVTGLYSASADSIPILCITGQAPRARMHKEDFQAVDITSIV 123

Query: 119 MPIVKHNFQIQKTCQIPEIFRSAFEIAQTGRPGPVHIDLPKDVQ--ELELDIDKHPIPSK 176
            P+ K    + +  Q+P  F+ AF   ++GRPGPV IDLP DVQ  E+E DID       
Sbjct: 124 KPVTKWATTVLEPGQVPYAFQKAFFEMRSGRPGPVLIDLPFDVQMAEIEFDID------- 176

Query: 177 VKLIGYNPTTIGHPR----QIKKAIKLIASAKRPIILAGGGVLLSGANEELLKLVELLNI 232
                Y P  +  P     QI+KA+ ++  A+RP+++AGGG++ + A++ L++  EL  I
Sbjct: 177 ----AYQPLPLAKPAANRVQIEKALAMLNQAERPLLVAGGGIINADASDLLVEFAELTGI 232

Query: 233 PVCTTLMGKGCISENHPLALGMVGMHGT-KPANYCLSESDVLISIGCRFSDRITGDIKSF 291
           PV  TLMG G I ++HP  +GMVG+  + +  N  L +SDV++ +G R+++R TG +  +
Sbjct: 233 PVIPTLMGWGTIPDDHPQMVGMVGLQTSHRYGNATLLKSDVVLGVGNRWANRHTGSVDVY 292

Query: 292 ATNAKIIHIDIDPAEIGKNVNVDVPIVGDAKLILKEVIKQLDYIINKDSKENNDKENISQ 351
                 IH+DI+P +IG+    D+ IV DA   L   I+     + ++ +     +N S 
Sbjct: 293 TEGRTFIHVDIEPTQIGRVFTPDLGIVSDAASALTVFIE-----VAREWQAAGKLKNRSA 347

Query: 352 WIENVNSLKKSSIPVMDYDDIPIKPQKIVKELMAVIDDLNINKNTIITTDVGQNQMWMAH 411
           W+++    K S      +D++P+KPQ++ +E+  V       K+T   + +G +Q+  A 
Sbjct: 348 WLQDCQQRKASLQRKTHFDNVPVKPQRVYEEMNQV-----FGKDTCYVSTIGLSQIAGAQ 402

Query: 412 YFKTQTPRSFLSSGGLGTMGFGFPSAIGAKVAKPDSKVICITGDGGFMMNCQELGTIAEY 471
           +     PR +++ G  G +G+  P+A+G   A P  KV+ ++GD  F    +EL   A++
Sbjct: 403 FLHVYKPRHWINCGQAGPLGWTIPAALGVVKADPSRKVVALSGDYDFQFMIEELAVGAQF 462

Query: 472 NIPVVICIFDNRTLGMVYQWQNLFYGKRQCSVNF---------GGAPDFIKLAESYGIKA 522
            +P +  + +N  LG++ Q Q  F       ++F         G   D + +AE  G KA
Sbjct: 463 KLPYIHVVVNNSYLGLIRQAQRGFDMDYCVQLSFDNLNAPELNGYGVDHVAVAEGLGCKA 522

Query: 523 RRIESPNEINEALKEAINCDE----PYLLDFAIDPSSALSM 559
            R+  P  I  AL++A    E    P +++  ++  + +SM
Sbjct: 523 LRVFEPAGIQPALRQAQAMIEEFKVPVIVEIILERVTNISM 563


Lambda     K      H
   0.319    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 804
Number of extensions: 39
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 599
Length of database: 591
Length adjustment: 37
Effective length of query: 562
Effective length of database: 554
Effective search space:   311348
Effective search space used:   311348
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory