GapMind for Amino acid biosynthesis

 

Aligments for a candidate for asp-kinase in Pseudomonas fluorescens FW300-N2C3

Align Aspartate kinase; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate AO356_18775 AO356_18775 aspartate kinase

Query= SwissProt::C3JXY0
         (413 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775 AO356_18775
           aspartate kinase
          Length = 413

 Score =  747 bits (1929), Expect = 0.0
 Identities = 393/413 (95%), Positives = 402/413 (97%)

Query: 1   MALIVQKFGGTSVGSVERIEQVADKVKKFRDAGDDLVVVLSAMSGETNRLIDLAKAISGD 60
           MALIVQKFGGTSVG+VERIEQVADKVKKFR+AGDDLVVVLSAMSGETNRLIDLAK ISGD
Sbjct: 1   MALIVQKFGGTSVGTVERIEQVADKVKKFREAGDDLVVVLSAMSGETNRLIDLAKQISGD 60

Query: 61  QQPLPRELDVIVSTGEQVTIALLAMALNKRGVPAVSYTGSQVRILTDSAHTKARILQIDD 120
           QQP+PRELDVIVSTGEQVTIALLAMAL KRGVPAVSYTG+QVRILTDSAH KARILQIDD
Sbjct: 61  QQPVPRELDVIVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHNKARILQIDD 120

Query: 121 QKIRTDLKAGRVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGV 180
           QKIR DLKAGRVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGV
Sbjct: 121 QKIRGDLKAGRVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGV 180

Query: 181 YTTDPRVVSVAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGT 240
           YTTDPRVV VAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGT
Sbjct: 181 YTTDPRVVPVAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGT 240

Query: 241 LITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISGANIEVDMIVQNV 300
           LITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPIS ANIEVDMIVQNV
Sbjct: 241 LITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANIEVDMIVQNV 300

Query: 301 SHDNTTDFTFTVHRNEYDAAERILQNTAKEIGAREVVGDTKIAKVSIVGVGMRSHAGVAS 360
           SHDNTTDFTFTVHRN+Y +AE IL+ TA EIGAREVVGDTKIAKVSIVGVGMRSHAGVAS
Sbjct: 301 SHDNTTDFTFTVHRNDYQSAEAILKKTAGEIGAREVVGDTKIAKVSIVGVGMRSHAGVAS 360

Query: 361 RMFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPARQGE 413
           RMFE+LAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDA A+QGE
Sbjct: 361 RMFESLAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAAAQQGE 413


Lambda     K      H
   0.316    0.133    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 699
Number of extensions: 21
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 413
Length of database: 413
Length adjustment: 31
Effective length of query: 382
Effective length of database: 382
Effective search space:   145924
Effective search space used:   145924
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate AO356_18775 AO356_18775 (aspartate kinase)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00656.hmm
# target sequence database:        /tmp/gapView.28360.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00656  [M=407]
Accession:   TIGR00656
Description: asp_kin_monofn: aspartate kinase, monofunctional class
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   3.8e-135  436.9  12.8   4.3e-135  436.8  12.8    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775  AO356_18775 aspartate kinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775  AO356_18775 aspartate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  436.8  12.8  4.3e-135  4.3e-135       1     406 [.       1     405 [.       1     406 [. 0.97

  Alignments for each domain:
  == domain 1  score: 436.8 bits;  conditional E-value: 4.3e-135
                                       TIGR00656   1 veliVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleai 63 
                                                     + liVqKFGGtsvg +eri+++a++v+k  + g++ vVV+SAms++t++l++la+    + + 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775   1 MALIVQKFGGTSVGTVERIEQVADKVKKFREAGDDLVVVLSAMSGETNRLIDLAK----QISG 59 
                                                     579***************************************************5....4455 PP

                                       TIGR00656  64 sdeisprerdelvsvGEllssallssalrelgvkaealdgkeagilTddefgnAkikelatee 126
                                                      +++ pre d +vs+GE++++all++al ++gv a++++g++  ilTd+ +++A+i +++  +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775  60 DQQPVPRELDVIVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHNKARILQIDD-Q 121
                                                     67889*******************************************************9.* PP

                                       TIGR00656 127 rLlelLeegiivvvaGFiGateeGeiTtLGRGGSDltAallaaalkAdrveiyTDVeGvyttD 189
                                                     ++   L+ g +vvvaGF+G +e+G+iTtLGRGGSD+t ++laaalkAd+++iyTDV+GvyttD
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775 122 KIRGDLKAGRVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYTTD 184
                                                     *************************************************************** PP

                                       TIGR00656 190 PrvveeakkidkisyeEalelAtlGakvlhpralelaveakvpilvrsskekeegTlitn... 249
                                                     Prvv+ a+++dki++eE+le+A+lG kvl+ ra+e+a +++vp++v +s+++  gTlit    
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775 185 PRVVPVAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGTLITIdee 247
                                                     **********************************************************98555 PP

                                       TIGR00656 250 .kkensslvkaialeknvarltvegegmlgkrgilaeifkaLaeeeinvdlisqtese...ts 308
                                                      ++e++ ++++ia++++ a+lt++  g+ + +g++ +i + ++ ++i vd+i+q  s+   t+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775 248 eSMEQP-IISGIAFNRDEAKLTIR--GVPDTPGVAFKILGPISAANIEVDMIVQNVSHdntTD 307
                                                     566666.*****************..9****************************9988999* PP

                                       TIGR00656 309 islvvdeedvdeakkaLkeesgaaelesleveedlavvsivgaglveapGvaseifkaleekn 371
                                                      +++v+++d ++a+++Lk++ g+++ +++  + ++a+vsivg+g++++ Gvas++f+ l+++ 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775 308 FTFTVHRNDYQSAEAILKKTAGEIGAREVVGDTKIAKVSIVGVGMRSHAGVASRMFESLAKES 370
                                                     *************************************************************** PP

                                       TIGR00656 372 inilmisssetkisvlvdekdaekavrklheklee 406
                                                     ini mis+se+k+sv+++ek++e avr+lh ++e+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18775 371 INIQMISTSEIKVSVVIEEKYLELAVRALHTAFEL 405
                                                     ********************************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (407 nodes)
Target sequences:                          1  (413 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 11.43
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory