GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapF in Pseudomonas fluorescens FW300-N2C3

Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate AO356_20725 AO356_20725 diaminopimelate epimerase

Query= curated2:Q3IZB6
         (279 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725 AO356_20725
           diaminopimelate epimerase
          Length = 267

 Score =  243 bits (620), Expect = 3e-69
 Identities = 126/264 (47%), Positives = 166/264 (62%), Gaps = 2/264 (0%)

Query: 10  LGFMKMHGAGNDFVVIDSRGRGGALVTAGLARALGDRHRGVGFDQLAEIRDQEGADCALD 69
           L F KMH  G+DFV++DSR    A VT+ +A  +GDR+RG+GF+QLA + D + AD  + 
Sbjct: 3   LSFHKMHANGDDFVIVDSRNSASA-VTSAMAHRMGDRNRGIGFNQLAVLLDCDDADARVM 61

Query: 70  FWNSDGSRSGTCGNATRCVSDYLMRDLGRDEVNLVTARGRLHARRREDGLVAVNMGAPQL 129
           FWN+DGS    CG+ATR  +D LMR+     + L T RG L   R   G ++V+MG P  
Sbjct: 62  FWNADGSALDVCGSATRGAADLLMREAHVTSLVLRTNRGLLTCERTPTGDISVDMGVPLF 121

Query: 130 LWSEIPLARAMETDSLPLEGTPSAVGMGNPHCIYFVEDAEAVDLAGRGAAVETDPLFPER 189
            WS+IPLA+ ++T +LPL  +P+A  MGNPHC YFV+D   VD+A  G  +ET+ LFP +
Sbjct: 122 GWSDIPLAQELDTAALPLADSPAACSMGNPHCTYFVDDLAGVDIATIGPTIETNALFPLK 181

Query: 190 TNVEFASLIGPDRLRLRVWERGAGITLACGSGACATAVAAARRGLTGRQVRLEMDGGVLE 249
           TNV F  +I    +RLR+WERGAGI L  GS +C   V   RRGL    V +E DGG + 
Sbjct: 182 TNVHFVQIIDRTHIRLRIWERGAGIALGSGSCSCGAVVNGIRRGLLDSTVEVECDGGSVT 241

Query: 250 VDWRDEG-VWLSGPVARVFEGHLS 272
           V W   G V+L GPV   F G +S
Sbjct: 242 VQWDGLGAVFLIGPVEASFSGTMS 265


Lambda     K      H
   0.321    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 260
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 279
Length of database: 267
Length adjustment: 25
Effective length of query: 254
Effective length of database: 242
Effective search space:    61468
Effective search space used:    61468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)

Align candidate AO356_20725 AO356_20725 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00652.hmm
# target sequence database:        /tmp/gapView.18994.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00652  [M=270]
Accession:   TIGR00652
Description: DapF: diaminopimelate epimerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
    1.9e-61  193.8   0.0    2.2e-61  193.6   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725  AO356_20725 diaminopimelate epim


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725  AO356_20725 diaminopimelate epimerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  193.6   0.0   2.2e-61   2.2e-61       2     268 ..       4     264 ..       3     266 .. 0.95

  Alignments for each domain:
  == domain 1  score: 193.6 bits;  conditional E-value: 2.2e-61
                                       TIGR00652   2 eFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvepsseeadvklrifN 64 
                                                     +F kmh++g dFv+vd++++ +  + +++++++ dr+ g+g+ ++ ++  + ++ad+++ ++N
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725   4 SFHKMHANGDDFVIVDSRNSASAVT-SAMAHRMGDRNRGIGFNQLAVLL-DCDDADARVMFWN 64 
                                                     79*****************888888.79*****************9999.59*********** PP

                                       TIGR00652  65 sDGSeaemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkke 127
                                                     +DGS+ + CG + R +a  ++ ++ +  ++l++ t++gl+++e + ++ +++vdmg p f  +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725  65 ADGSALDVCGSATRGAADLLMREAHV--TSLVLRTNRGLLTCERTPTG-DISVDMGVPLFGWS 124
                                                     ************************99..8*******************.************** PP

                                       TIGR00652 128 eipltvekeeekeellalevlvvdvGnPHlvvfvedvekldleelgklleaheefpegvNvef 190
                                                     +ipl +e ++    l+  +  + ++GnPH+  fv+d+ ++d+ ++g+++e++  fp ++Nv+f
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725 125 DIPLAQELDTAALPLAD-SPAACSMGNPHCTYFVDDLAGVDIATIGPTIETNALFPLKTNVHF 186
                                                     *****977777333332.33699**************************************** PP

                                       TIGR00652 191 vevkkedeiklrvyERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedgk 253
                                                     v++ ++ +i+lr++ERGag+ l  G+ ++ ++v +++ g++++ v+v+ +gg++++++   g 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725 187 VQIIDRTHIRLRIWERGAGIALGSGSCSCGAVVNGIRRGLLDSTVEVECDGGSVTVQWDGLGA 249
                                                     *************************************************************** PP

                                       TIGR00652 254 vyltGpavlvlegel 268
                                                     v+l Gp++  ++g++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20725 250 VFLIGPVEASFSGTM 264
                                                     ********9999986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (270 nodes)
Target sequences:                          1  (267 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.23
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory