Align Homoisocitrate dehydrogenase; HICDH; Homo(2)-isocitrate/homo(3)-isocitrate dehydrogenase; Isohomocitrate dehydrogenase; IHDH; NAD-dependent threo-isohomocitrate dehydrogenase; EC 1.1.1.87; EC 1.1.1.- (characterized)
to candidate AO356_26735 AO356_26735 tartrate dehydrogenase
Query= SwissProt::Q58991 (347 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_26735 Length = 359 Score = 196 bits (498), Expect = 8e-55 Identities = 126/357 (35%), Positives = 198/357 (55%), Gaps = 30/357 (8%) Query: 3 KVCVIEGDGIGKEVIPEAIKILNELGE-------FEIIKGEAGLECLKKYGNALPEDTIE 55 ++ I GDGIGKEV+PE +++L + + E++ A + ++G +P D Sbjct: 6 RIAAIAGDGIGKEVLPEGLRVLEQAAKKWQLDLSIEVLDW-AHCDYYLEHGQMMPADWFA 64 Query: 56 KAKEADIILFGAITSPK--PGEVKNYKSPIITLRKMFHLYANVRPINNFGIGQLIGKIAD 113 + K+ D I FGA+ P P + + S ++ R+ F Y N+RP+ F G Sbjct: 65 QLKDFDAIYFGAVGWPDKVPDHISLWGS-LLKFRRDFDQYVNIRPVRLFP-----GVPCP 118 Query: 114 YEFLNAKNIDIVIIRENTEDLY--VGR---ERLENDTAIAERVITRKGSERIIRFAFEYA 168 A +ID V+IRENTE Y +G E E++ + E V TR+G +RI++FAF+ A Sbjct: 119 LAGREAGDIDFVVIRENTEGEYSSIGGKMFEGTEHEFVLQESVFTRRGVDRILKFAFDLA 178 Query: 169 IKNNRKKVSCIHKANVLRITDGLFLEVFNEIKKHY-NIEADDYLVDSTAMNLIKHPEKFD 227 RK+++ K+N + I+ + E + + Y ++ D +D + P++FD Sbjct: 179 QTRPRKRLTAATKSNGISISMPYWDERTALMAQQYPDVTWDKQHIDILCARFVLQPDRFD 238 Query: 228 VIVTTNMFGDILSDEASALIGGLGLAPSANIGDDK---ALFEPVHGSAPDIAGKGIANPM 284 V+V +N+FGDILSD A G +G+APSAN+ ++ +LFEPVHGSAPDI G+ IANP+ Sbjct: 239 VVVASNLFGDILSDLGPACAGTIGIAPSANLDPERRFPSLFEPVHGSAPDIYGRNIANPI 298 Query: 285 ASILSIAMLFDYIGEKEK-----GDLIREAVKYCLINKKVTPDLGGDLKTKDVGDEI 336 A I S A++ D++G ++ D I A++ + +TPDLGG T+DVG I Sbjct: 299 AMIWSGALMLDFLGNGDERYRAAHDGILRAIEQVIAEGPITPDLGGQGSTQDVGQAI 355 Lambda K H 0.319 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 15 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 359 Length adjustment: 29 Effective length of query: 318 Effective length of database: 330 Effective search space: 104940 Effective search space used: 104940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory