Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate AO356_27130 AO356_27130 cystathionine gamma-lyase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_27130 Length = 400 Score = 205 bits (522), Expect = 2e-57 Identities = 136/386 (35%), Positives = 194/386 (50%), Gaps = 10/386 (2%) Query: 18 ATQAIRGGT-ARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQQGMTYSRLQNPTVEML 76 AT A+ GG A G L + + Y D A G+ Y+R Q L Sbjct: 14 ATLAVHGGNVADVTSGAVRTPLVMANSYLLP--EDPATMDWSSPDGLVYTRNQGHNQVCL 71 Query: 77 EQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGSCRWLTDTQLP-KFG 135 E+++A LEG E A+G+AA+ + L +GDH+I + + L LP ++G Sbjct: 72 EKKLAALEGCEDAVVFATGVAALHSVFFSFLKSGDHVIVSDITYQAVWRLFAELLPERYG 131 Query: 136 IETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIARERGIVTVVDNAF 195 IE T VD D + +AIRPNTK+ ET ANPT V D+ A+ IA G + VD F Sbjct: 132 IEATFVDVGDLESVRNAIRPNTKLIHTETIANPTTKVADIAALAEIAHAHGALISVDATF 191 Query: 196 ATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLPFHRNTGPTLSPF 255 P R G D V +S TK ++G G + G V G+ IN + G T+SPF Sbjct: 192 TPPPFFRASQHGVDFVIHSLTKYINGHGDAMGGVVIGSNPLINKIKNDALVDLGATISPF 251 Query: 256 NAWVVLKGLETLDLRIQRQSENALKVARFLEG--RVPRVNFPGLPSHPQHNLAMSQMAAA 313 NAW++++G TL LR+++ A K+A+FL+ R+ V +PGLPSHPQH LA Q A Sbjct: 252 NAWMIMRGSVTLPLRLKQLLNTAEKLAQFLDSDDRIAYVYYPGLPSHPQHKLARRQFAGK 311 Query: 314 --GPIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHSGVAEDQRLLMG 371 G + + ++G + + L +I + ++G SL+ H + G + Sbjct: 312 GYGAVMAFAVEGDPDTQNRFVSNLRIITSAVSLGHDESLIVHVGAEGRGGFDKYPEEFRQ 371 Query: 372 VGEGMLRLNVGLEDPEDLIADLDQAL 397 G LR +VGLEDPEDLI D+ AL Sbjct: 372 YGH--LRFSVGLEDPEDLIKDITFAL 395 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 400 Length adjustment: 31 Effective length of query: 371 Effective length of database: 369 Effective search space: 136899 Effective search space used: 136899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory