Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate AO356_25850 AO356_25850 GNAT family acetyltransferase
Query= BRENDA::Q9I3W7 (177 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_25850 Length = 165 Score = 234 bits (596), Expect = 7e-67 Identities = 117/163 (71%), Positives = 134/163 (82%), Gaps = 2/163 (1%) Query: 7 TIRLERYSERHVEGLTALYNDPAVARQVLQMPYQSVEQRRKRLHDSADDDRLLILVALHQ 66 +I L R++E H+ G+TALYNDPAV RQVLQMP+QS E RKRL + DD+RLL LVALH Sbjct: 5 SITLARFTEAHIAGVTALYNDPAVTRQVLQMPFQSTEVWRKRL--ATDDERLLKLVALHT 62 Query: 67 GDVIGSASLEQHPRIRRSHSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELT 126 GDVIG+ LEQ R+RR+H GS+GMGVAVAWQGKGVGS LL LD+ADNWMNLRRVELT Sbjct: 63 GDVIGNLGLEQFSRVRRAHCGSLGMGVAVAWQGKGVGSMLLAAALDVADNWMNLRRVELT 122 Query: 127 VYTDNAPALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARLR 169 VY DN A+ LYRKFGFE+EG MRDYAVRDGR+VD +MARLR Sbjct: 123 VYADNEAAIGLYRKFGFESEGLMRDYAVRDGRWVDTLAMARLR 165 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 177 Length of database: 165 Length adjustment: 18 Effective length of query: 159 Effective length of database: 147 Effective search space: 23373 Effective search space used: 23373 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory