Align Acetylglutamate kinase; EC 2.7.2.8; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK (uncharacterized)
to candidate AO356_13085 AO356_13085 N-acetylglutamate synthase
Query= curated2:A6VI50 (294 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_13085 Length = 432 Score = 110 bits (274), Expect = 7e-29 Identities = 88/286 (30%), Positives = 139/286 (48%), Gaps = 11/286 (3%) Query: 10 LIEALPYICKFHDQKVLIKYGGHAMVNEQAKNWIAKDLVLLKYVGINPIVVHGGGPEINR 69 L A PYI D ++ G + + N I DLVLL +G+ ++VHG P+I Sbjct: 8 LRHASPYINAHRDCTFIVMLPGDGVEHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQIET 66 Query: 70 AMEKMGKTPEFIHGLRVTDEETLEIVKMVLIGKINGDIVSKLELYGGKAVGLSGKSGQLI 129 + G TP + HG+R+TD TLE V + +G++ I ++L + + S G + Sbjct: 67 RLAARGLTPHYHHGMRITDAATLECV-IDAVGQLRIAIEARLSM----DMASSPMQGSRL 121 Query: 130 KAKKKIQYLMKDSQKIE-VDLGMVGEVEHVDTKLIDILVEKRYIPVISPIGVDHQGNDLN 188 + + +E VD GEV VD K I+ L+++R I ++SP+G G N Sbjct: 122 RVASGNLVTARPIGVLEGVDYHHTGEVRRVDRKGINRLLDERSIVLLSPLGYSPTGEIFN 181 Query: 189 LNADIAAGDIAGAMNAEKLIMVTDVDGIMDDIKDPSTLHRKLTISQIEGMIERGLITGGM 248 L + A A + A+KL++ G+ I + L R+L Q+ G ++R L + Sbjct: 182 LACEDVATRAAIDLAADKLLLFGAEQGL---IGEDGRLVRELRPQQVPGHMQR-LGSDYQ 237 Query: 249 IPKIEACINALDKGVQSVHIVNGKTPHAVLLEIFTEDGVGTMVVRE 294 ++A A GV HIV+ A+L E+FT DG GT+V +E Sbjct: 238 AELLDAAAQACRGGVARSHIVSYAEDGALLAELFTRDGSGTLVAQE 283 Lambda K H 0.318 0.139 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 432 Length adjustment: 29 Effective length of query: 265 Effective length of database: 403 Effective search space: 106795 Effective search space used: 106795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory