GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serB in Pseudomonas fluorescens FW300-N2C3

Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate AO356_08735 AO356_08735 phosphoserine phosphatase

Query= SwissProt::Q9S281
         (410 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08735 AO356_08735
           phosphoserine phosphatase
          Length = 404

 Score =  268 bits (685), Expect = 2e-76
 Identities = 168/392 (42%), Positives = 224/392 (57%), Gaps = 16/392 (4%)

Query: 12  LLVKIFGKDRPGITAGLFDTLAAYSVDVVDIEQVVTRGRIVLCALVTEPPRGLEGDLRAT 71
           +L+ I G DRPG+TA +   LA   V+++DI Q V    +    LV  P       +   
Sbjct: 5   VLINITGSDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLSFGILVEIPDAEQSKSVLKD 64

Query: 72  VHSWAESLKLQAEIISGIGDNRP-----RGFGRSLVTVLGHPLTAEATAAIAARITESGS 126
           +   A  L  Q        ++       +G  R +VT+L   +TAE    +++   + G 
Sbjct: 65  ILFTAYKLDQQVRFTPVSEEDYQHWVAGQGKKRHIVTLLTRKVTAEQLQRVSSITAQYGL 124

Query: 127 NIDRIFRLA-KYPVTA--------VEFAVSGVETEP--LRTALATEAAALGVDIAVVAAG 175
           NID I RL+ + P+          +EF+V G   +P  LR    + A  L VDIA     
Sbjct: 125 NIDHIDRLSGRMPLDTPADKGKGCIEFSVRGEPADPQALRAEFLSVAQELNVDIAFQEDS 184

Query: 176 LHRRAQRLVVMDVDSTLIQDEVIELFAAHAGCEDEVAEVTAAAMRGELDFEQSLHARVAL 235
           L RR +RL V D+DSTLI+ EVI+  A  AG  D+V+ +T  AM GELDF  S   R+AL
Sbjct: 185 LFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGDKVSAITERAMAGELDFRASFKERLAL 244

Query: 236 LAGLDASVVDKVRAEVRLTPGARTLIRTLKRLGYQVGVVSGGFTQVTDALQEQLGLDFAQ 295
           L GLD SV+D + A +RLT GA TL   LKRLGY+  ++SGGFT     LQ +LG+D+  
Sbjct: 245 LKGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTAILSGGFTYFAKQLQAKLGIDYVF 304

Query: 296 ANTLEIVDGRLTGRVTGEIVDRAGKARLLRRFAAAAGVPLSQTVAIGDGANDLDMLNAAG 355
           AN LE+VDG++TG     IVD   KA LLR  AA  G+ L QT+A+GDGANDL ML  AG
Sbjct: 305 ANELEVVDGKVTGVAVEPIVDAQRKADLLRELAAKEGLRLEQTIAVGDGANDLPMLAIAG 364

Query: 356 LGVAFNAKPVVREAAHTAVNVPFLDTVLYLLG 387
           LGVAF AKP+V+++A  A++   LD VLYLLG
Sbjct: 365 LGVAFRAKPLVKQSARQAISTLGLDGVLYLLG 396


Lambda     K      H
   0.319    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 381
Number of extensions: 18
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 410
Length of database: 404
Length adjustment: 31
Effective length of query: 379
Effective length of database: 373
Effective search space:   141367
Effective search space used:   141367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate AO356_08735 AO356_08735 (phosphoserine phosphatase)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00338.hmm
# target sequence database:        /tmp/gapView.19097.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00338  [M=219]
Accession:   TIGR00338
Description: serB: phosphoserine phosphatase SerB
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
    2.7e-83  264.9   0.5    3.5e-83  264.5   0.5    1.1  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08735  AO356_08735 phosphoserine phosph


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08735  AO356_08735 phosphoserine phosphatase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  264.5   0.5   3.5e-83   3.5e-83       1     219 []     177     395 ..     177     395 .. 0.99

  Alignments for each domain:
  == domain 1  score: 264.5 bits;  conditional E-value: 3.5e-83
                                       TIGR00338   1 diakselskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslr 63 
                                                     dia +e+s ++++++l+vfD+Dstlie+EvIde+ak+aGv+++Vs+iTerAm geldF++s++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08735 177 DIAFQEDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGDKVSAITERAMAGELDFRASFK 239
                                                     688999999****************************************************** PP

                                       TIGR00338  64 eRvkllkglpvellkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLglda 126
                                                     eR++llkgl+v++l+ +  +l+lteG+e l  +Lk+ gyk+a++SGgF+++a++l++kLg+d+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08735 240 ERLALLKGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTAILSGGFTYFAKQLQAKLGIDY 302
                                                     *************************************************************** PP

                                       TIGR00338 127 vfaNrLevedgkltGkvegeivdesakaktllkllekegislektvavGDGanDlsmikaAgl 189
                                                     vfaN+Lev dgk tG    +ivd++ ka+ l +l+ keg+ le+t+avGDGanDl+m++ Agl
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08735 303 VFANELEVVDGKVTGVAVEPIVDAQRKADLLRELAAKEGLRLEQTIAVGDGANDLPMLAIAGL 365
                                                     *************************************************************** PP

                                       TIGR00338 190 giafnakpvlkekadiviekkdltdilell 219
                                                     g+af akp +k+ a ++i++  l ++l+ll
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08735 366 GVAFRAKPLVKQSARQAISTLGLDGVLYLL 395
                                                     ********************9999999886 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (219 nodes)
Target sequences:                          1  (404 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00
# Mc/sec: 11.45
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory