Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate AO356_15130 AO356_15130 threonine synthase
Query= BRENDA::Q8YFS0 (463 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_15130 Length = 454 Score = 330 bits (845), Expect = 8e-95 Identities = 176/415 (42%), Positives = 251/415 (60%), Gaps = 7/415 (1%) Query: 1 MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT 60 M+YVSTR A + F +L+ +A DGGL++P E PQF ++ I +Y E+A V+ Sbjct: 1 MRYVSTRNSAVQVDFEKVVLSAIAEDGGLFVPVELPQFESQDIANWSTLAYDELAYRVMR 60 Query: 61 PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA 120 PF G IP ADF+R+++EA F H ++ PL Q D NE+VLELFHGPT + KD A QL A Sbjct: 61 PFVGEAIPEADFKRVLKEAGSQFSHRSLAPLHQVDRNEWVLELFHGPTRSSKDFAAQLQA 120 Query: 121 RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS 180 R++ Y L +RG RA ++G T+GDTG AAIEAF D TD+ +++P V Q + + ++ Sbjct: 121 RLVQYFLRKRGRRAVVIGVTNGDTGLAAIEAFKHCDETDVVVIYPEAGVLQDQLQDLQAT 180 Query: 181 GFSNVHALSIEGNFDDCQNLVKGMFNDLEFCDALSLSGVNSINWARIMPQVVYYFTAALS 240 VH ++++G+FD+CQ LV +F E A+S NS NW +M Q+V+YF A L Sbjct: 181 AHPRVHQVAVDGSFDECQTLVTQLFRQHE---AISF---NSSNWVSVMAQLVFYFHAVLQ 234 Query: 241 LGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMRGV 300 LG R + F+VP +F +++AGY+A++MGLPI Q+I+ATN ND L + Y Sbjct: 235 LGGGQRPIGFSVPAASFAEVYAGYIAQKMGLPITQMIVATNQNDALHQFFLKNHYSRLRA 294 Query: 301 AQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEFSA 360 ++T SP+MD+ I SN ER L+E +G D AV LM + G TI+ + R + Sbjct: 295 SKTLSPAMDLSIFSNLERFLWELYGHDDQAVSALMHTFETRGEMTIANEFWLQARMIIDS 354 Query: 361 GRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAR-EKASGTAPMVVLATAHPAK 414 + ++T I S+ GY++DPH+A GV AR + S APMV L PAK Sbjct: 355 YAVSDEQTLEEITSLYRDTGYVIDPHTATGVLAARLYRRSLVAPMVTLGEISPAK 409 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 454 Length adjustment: 33 Effective length of query: 430 Effective length of database: 421 Effective search space: 181030 Effective search space used: 181030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate AO356_15130 AO356_15130 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.8357.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-60 190.7 0.0 2.6e-60 190.3 0.0 1.1 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 AO356_15130 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 AO356_15130 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 190.3 0.0 2.6e-60 2.6e-60 12 308 .. 69 389 .. 58 415 .. 0.83 Alignments for each domain: == domain 1 score: 190.3 bits; conditional E-value: 2.6e-60 TIGR00260 12 ekdlvdlaegstelfrspkla..eevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelg 72 e+d + + + + f la ++v n +v+elfhgPt + KD++ q a l++++l + lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 69 EADFKRVLKEAGSQFSHRSLAplHQVDR-NEWVLELFHGPTRSSKDFAAQLQARLVQYFLRKR 130 5566666555556665554443377776.99***************************98654 PP TIGR00260 73 ne..tvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkekl..vt.alaenakvlaik 130 +v++ t Gdtg aa+ea++ + +vvv+yP+ ++ +++l ++ + ++ +a++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 131 GRraVVIGVTNGDTGLAAIEAFKHCDETDVVVIYPEAGVL--QDQLqdLQaTAHPRVHQVAVD 191 4335999*****************************9998..55542244044557999**** PP TIGR00260 131 GdFDdaqdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvpsgn 193 G FD++q+lv+++f ++e++ +ns N + + aq + +f +v qlg + + ++vp++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 192 GSFDECQTLVTQLFRQHEAISFNSSN---WVSVMAQLVFYFHAVLQLG-GGQRPIGFSVPAAS 250 **************999999998888...*******************.56678********* PP TIGR00260 194 fgailkGflekkelglpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnve 256 f ++++G+ + k++ lpi + +a++++ d +++f + + + + +Tls+Amd ++ sn e lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 251 FAEVYAGYIAQKMG-LPITQMIVATNQN-DALHQFFLKNHYSRLRASKTLSPAMDLSIFSNLE 311 *************9.********99999.777777666668889999**************** PP TIGR00260 257 rale.larrslgnledlke.........................svsdeeileaikklaeeeg 293 r l+ l + ++ + +l + +vsde++le+i l++ g lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 312 RFLWeLYGHDDQAVSALMHtfetrgemtianefwlqarmiidsyAVSDEQTLEEITSLYRDTG 374 ***96666666777777559999**************************************** PP TIGR00260 294 yllephtavavaalk 308 y+++phta++v a + lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 375 YVIDPHTATGVLAAR 389 ***********9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (454 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.26 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory