Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate AO356_15130 AO356_15130 threonine synthase
Query= curated2:P29363 (469 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_15130 Length = 454 Score = 422 bits (1084), Expect = e-122 Identities = 202/428 (47%), Positives = 290/428 (67%), Gaps = 6/428 (1%) Query: 1 MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTLEEIASWVGLPYHELAFRVMR 60 MRY+STR A ++FE V+L+ +A DGGL+VP LP+F ++IA+W L Y ELA+RVMR Sbjct: 1 MRYVSTRNSAVQVDFEKVVLSAIAEDGGLFVPVELPQFESQDIANWSTLAYDELAYRVMR 60 Query: 61 PFVAGSIADADFKKILEETYGVFAHDAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG 120 PFV +I +ADFK++L+E F+H ++APL Q++ NEWVLELFHGPT + KDFA QL Sbjct: 61 PFVGEAIPEADFKRVLKEAGSQFSHRSLAPLHQVDRNEWVLELFHGPTRSSKDFAAQLQA 120 Query: 121 RLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIFIMHPHNRVSEVQRRQMTTI 180 RL+ + L KRG R V++G T+GDTG AAIE + CD D+ +++P V + Q + + Sbjct: 121 RLVQYFLRKRGRRAVVIGVTNGDTGLAAIEAFKHCDETDVVVIYPEAGVLQDQLQDLQAT 180 Query: 181 LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ 240 +H +A++G+FD+CQ +V F ++ NS NW +MAQ+V+YFHA LQ Sbjct: 181 AHPRVHQVAVDGSFDECQTLVTQLFRQH------EAISFNSSNWVSVMAQLVFYFHAVLQ 234 Query: 241 LGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNRYDKDTL 300 LG R + FSVP +F +++AGY+A+ MGLP++Q+IVATN+ND LH+F N Y + Sbjct: 235 LGGGQRPIGFSVPAASFAEVYAGYIAQKMGLPITQMIVATNQNDALHQFFLKNHYSRLRA 294 Query: 301 HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKASGKLSVEDQRWTEARKLFDS 360 +LSP+MD+ + SN ER L++L+G + +AV+ L+ F+ G++++ ++ W +AR + DS Sbjct: 295 SKTLSPAMDLSIFSNLERFLWELYGHDDQAVSALMHTFETRGEMTIANEFWLQARMIIDS 354 Query: 361 LAVSDEQTCETIAEVYRSSGELLDPHTAIGVRAARECRRSLSVPMVTLGTAHPVKFPEAV 420 AVSDEQT E I +YR +G ++DPHTA GV AAR RRSL PMVTLG P K + + Sbjct: 355 YAVSDEQTLEEITSLYRDTGYVIDPHTATGVLAARLYRRSLVAPMVTLGEISPAKSAQLL 414 Query: 421 EKAGIGQA 428 + GI A Sbjct: 415 GELGISIA 422 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 526 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 454 Length adjustment: 33 Effective length of query: 436 Effective length of database: 421 Effective search space: 183556 Effective search space used: 183556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
Align candidate AO356_15130 AO356_15130 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.3623.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-60 190.7 0.0 2.6e-60 190.3 0.0 1.1 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 AO356_15130 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 AO356_15130 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 190.3 0.0 2.6e-60 2.6e-60 12 308 .. 69 389 .. 58 415 .. 0.83 Alignments for each domain: == domain 1 score: 190.3 bits; conditional E-value: 2.6e-60 TIGR00260 12 ekdlvdlaegstelfrspkla..eevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelg 72 e+d + + + + f la ++v n +v+elfhgPt + KD++ q a l++++l + lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 69 EADFKRVLKEAGSQFSHRSLAplHQVDR-NEWVLELFHGPTRSSKDFAAQLQARLVQYFLRKR 130 5566666555556665554443377776.99***************************98654 PP TIGR00260 73 ne..tvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkekl..vt.alaenakvlaik 130 +v++ t Gdtg aa+ea++ + +vvv+yP+ ++ +++l ++ + ++ +a++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 131 GRraVVIGVTNGDTGLAAIEAFKHCDETDVVVIYPEAGVL--QDQLqdLQaTAHPRVHQVAVD 191 4335999*****************************9998..55542244044557999**** PP TIGR00260 131 GdFDdaqdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvpsgn 193 G FD++q+lv+++f ++e++ +ns N + + aq + +f +v qlg + + ++vp++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 192 GSFDECQTLVTQLFRQHEAISFNSSN---WVSVMAQLVFYFHAVLQLG-GGQRPIGFSVPAAS 250 **************999999998888...*******************.56678********* PP TIGR00260 194 fgailkGflekkelglpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnve 256 f ++++G+ + k++ lpi + +a++++ d +++f + + + + +Tls+Amd ++ sn e lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 251 FAEVYAGYIAQKMG-LPITQMIVATNQN-DALHQFFLKNHYSRLRASKTLSPAMDLSIFSNLE 311 *************9.********99999.777777666668889999**************** PP TIGR00260 257 rale.larrslgnledlke.........................svsdeeileaikklaeeeg 293 r l+ l + ++ + +l + +vsde++le+i l++ g lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 312 RFLWeLYGHDDQAVSALMHtfetrgemtianefwlqarmiidsyAVSDEQTLEEITSLYRDTG 374 ***96666666777777559999**************************************** PP TIGR00260 294 yllephtavavaalk 308 y+++phta++v a + lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_15130 375 YVIDPHTATGVLAAR 389 ***********9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (454 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.84 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory