Align threonine synthase; EC 4.2.3.1 (characterized)
to candidate AO356_16855 AO356_16855 threonine synthase
Query= CharProtDB::CH_107419 (405 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_16855 Length = 417 Score = 206 bits (524), Expect = 1e-57 Identities = 132/383 (34%), Positives = 200/383 (52%), Gaps = 11/383 (2%) Query: 2 YHLKCIECGAEYSRDEVIYTCSKC--DGLLDVIYDYSSIKIDMEK---LKTECPSVWKYA 56 Y L+C+ C Y EV Y C C DG LD +YDY ++K + + +W+Y Sbjct: 8 YVLQCLVCDRSYQPHEVSYYCPHCNIDGALDALYDYPTLKREWSRDSLAHDHARGMWRYD 67 Query: 57 KLLPVEREPVT--IQEGGTPLYKCDRLAEKIGIKKLYVKHEGMNPTGSFKDRGMTVGVTK 114 +L+P+ + G TPLY L K K++VK E PTGS KDR + V Sbjct: 68 RLMPLSSTQFIPPLLVGNTPLYSRPELLGKGARIKVFVKDESRQPTGSLKDRASALAVAH 127 Query: 115 ALELGMNTVACASTGNTSAALAIYGAKAGIPVVVLLPAGKVALGKVAQALMHGAKVLSIR 174 A++ G TVA ASTGN ++ALA A G+ V+ LP K+AQ +GA+++ + Sbjct: 128 AMQSGARTVAVASTGNAASALAGMSASLGLHNVIYLPKS-APREKLAQMQGYGAEIVLVD 186 Query: 175 GNFDDALALVRTLCSQEKIY-LLNSINPYRLEGQKTIGFEIADQLDFKVPDRIVLPVGNA 233 G +D+A C + Y IN Y EG+KT+ FE+ +QL+++VPD + +PVGN Sbjct: 187 GQYDEAFEQCLNACEKHGWYNRTTGINSYMSEGKKTVAFEMCEQLNWQVPDLVFVPVGNG 246 Query: 234 GNITAIYKGFREFKILGITDSLPKMTGIQAEGSCPIVKAIKSGAPAITPEENPET-VATA 292 + ++YKGF + LG + +P++ G+QAE S + +A + E P T +A++ Sbjct: 247 CILGSVYKGFFDLLQLGWIERIPRLIGVQAEHSNFMYRAWRHDRSMQQTERLPPTSLASS 306 Query: 293 IRIGNPVNATKALSAIRESGGTAESVTDEEILAAQKDLARLEGIGVEPASAASVAGLRKL 352 I + P + KA+ A+ S G V+D I+AA LA G+ E +A++ AGL K Sbjct: 307 INVALPRDRLKAMRAVTASDGEFICVSDPSIVAAASRLAASTGVFPEAGAASAFAGLLKY 366 Query: 353 VDMGVIGRDETVVCITTGHLLKD 375 + +T V + TG LKD Sbjct: 367 AETHP-DTPQTAVILITGSGLKD 388 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 417 Length adjustment: 31 Effective length of query: 374 Effective length of database: 386 Effective search space: 144364 Effective search space used: 144364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate AO356_16855 AO356_16855 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.19347.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-55 174.2 0.0 2.3e-55 174.0 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 AO356_16855 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 AO356_16855 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 174.0 0.0 2.3e-55 2.3e-55 1 339 [. 63 389 .. 63 390 .. 0.92 Alignments for each domain: == domain 1 score: 174.0 bits; conditional E-value: 2.3e-55 TIGR00260 1 vvryreilevt.ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfva 62 ++ry +++ + + + l g+t+l+ p+l + +++vk+++ Pt++ KDr+ a lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 63 MWRYDRLMPLSsTQFIPPLLVGNTPLYSRPELLGKGARIKVFVKDESRQPTGSLKDRA---SA 122 699999999996666678999**********9955555599*****************...99 PP TIGR00260 63 vlltkalelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenak 125 ++++a + g+ tv++A++G+ ++a+a ++++ +++ v+ +Pk ekl++ ++a+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 123 LAVAHAMQSGARTVAVASTGNAASALA-GMSASLGLHNVIYLPKS-AP--REKLAQMQGYGAE 181 ***************************.****************9.33..7************ PP TIGR00260 126 vlaikGdFDdaqdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvp 188 ++ ++G++D+a + + +++e++ ++ in + e++kt+afe++eql+++ pd v vp lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 182 IVLVDGQYDEAFEQCLNACEKHGWYN--RTTGINSYMSEGKKTVAFEMCEQLNWQVPDLVFVP 242 *******************7655443..33345599*************************** PP TIGR00260 189 vp.sgnfgailkGflekkelg....lpieklaiaaegaadivrrflksgdlepkedk..eTls 244 v+ + +g+++kGf+ + +lg p + ++++ae ++ ++r+ ++++ +++ e++ l+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 243 VGnGCILGSVYKGFFDLLQLGwierIP-RLIGVQAEHSNFMYRAWRHDRSMQQTERLppTSLA 304 **99999*****************999.*********************777777766699** PP TIGR00260 245 tAmdignpsnveralelarrslgnledlkesvsdeeileaikklaeeegyllephtavavaal 307 ++++ p + +a++++ s+g++ + sd +i+ a +la++ g++ e +a a a+l lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 305 SSINVALPRDRLKAMRAVTASDGEFICV----SDPSIVAAASRLAASTGVFPEAGAASAFAGL 363 *************************999....******************************* PP TIGR00260 308 kklvekgvsatadpaKFeevvealtgnklkdp 339 +k +e +p+ +++v +tg +lkd lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16855 364 LKYAET------HPDTPQTAVILITGSGLKDT 389 **9883......6887799**********985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (417 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.10 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory