Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate AO356_20840 AO356_20840 aminodeoxychorismate synthase component I
Query= curated2:P05378 (462 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_20840 Length = 447 Score = 251 bits (642), Expect = 3e-71 Identities = 154/365 (42%), Positives = 205/365 (56%), Gaps = 11/365 (3%) Query: 96 PFFGGVVGYAAYDLVRYYERLPSLKPDDLGLPDLLFVEPEVVAVFDHLKNLLHLVAP--- 152 PF GG++GY +YD R+ E LPS DDL LPD F + + DH LV Sbjct: 88 PFAGGLIGYLSYDFGRHLETLPSHAQDDLQLPDARFGVYDWALISDHQAGTSQLVFHPHC 147 Query: 153 GRDPEEAEARLFWAERRLKGPLPGVPGERAGGRARFQADFSREAYLEAVRRALDYIRAGD 212 G D + LF P + G D S EAY +A R YI+AGD Sbjct: 148 GEDERQRLIALFSQPTTAAVPSFSLEGPMT-------PDLSAEAYRQAFERIQAYIQAGD 200 Query: 213 IFQVVLSLRLSSPLTVHPFALYRALRSVNPSPYMGYLDLGEV-VLVSASPESLLRSDGRR 271 +QV + R +P +A Y+ALR+ P+P+ G+ L E ++S SPE ++ + Sbjct: 201 CYQVNFAQRFRAPCQGDAWAAYQALRAACPTPFSGFQSLPEGGAVLSLSPERFVKVSEGQ 260 Query: 272 VVTRPIAGTRPRGKDEEEDKRLAEELLRDEKEVAEHVMLLDLSRNDIGRVAAFGTVRVLE 331 V TRPI GTRPRG EED A ELL K+ AE++M++DL RND+GR G+VRV E Sbjct: 261 VETRPIKGTRPRGTTPEEDAAHAAELLASPKDRAENLMIVDLLRNDLGRTCRIGSVRVPE 320 Query: 332 PLHVEHYSHVMHLVSTVEGILAEGKTPLDALASVLPMGTVSGAPKIRAMEIIEELEPHRR 391 +E Y +V HLVS+V G LA+ K LD +A P G+++GAPKIRAM+II+ELEP RR Sbjct: 321 LFSLESYPNVHHLVSSVTGELADDKDALDLIAGSFPGGSITGAPKIRAMQIIDELEPTRR 380 Query: 392 GPYGGSFGYLAYDGAMDMALTLRTFVVAKGWMHVQAGAGIVADSVPEREYEECWNKARAL 451 G Y GS YL G MD ++ +R+ +V G + G GIVADS E EY+E K R L Sbjct: 381 GLYCGSLLYLDVRGEMDSSIAIRSLLVKDGQVCCWGGGGIVADSDWEAEYQESITKVRVL 440 Query: 452 LKAVE 456 L+ ++ Sbjct: 441 LETLQ 445 Lambda K H 0.321 0.139 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 462 Length of database: 447 Length adjustment: 33 Effective length of query: 429 Effective length of database: 414 Effective search space: 177606 Effective search space used: 177606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory