Align aspartate transaminase (EC 2.6.1.1); aspartate-prephenate aminotransferase (EC 2.6.1.78); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate AO356_25355 AO356_25355 aspartate aminotransferase
Query= BRENDA::Q02635 (400 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_25355 Length = 404 Score = 466 bits (1200), Expect = e-136 Identities = 225/393 (57%), Positives = 292/393 (74%) Query: 8 LSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAIDRGETKYTPV 67 L+R + SAT + + E +A+G +I L AGEPDFDTP +I++AAI+AI +G T+YT V Sbjct: 12 LARAQSSATYRIMDRVAERRAQGAKIISLCAGEPDFDTPKHIREAAIEAIGQGHTRYTQV 71 Query: 68 SGIPELREAIAKKFKRENNLDYTAAQTIVGTGGKQILFNAFMATLNPGDEVVIPAPYWVS 127 +G+ LREA+A KF++EN LD T T+V GGKQ+++NA ATL+ GD+V++PAPYWVS Sbjct: 72 AGVRSLREAVAAKFRQENGLDVTWQDTLVCNGGKQVIYNALAATLDEGDQVIVPAPYWVS 131 Query: 128 YPEMVALCGGTPVFVPTRQENNFKLKAEDLDRAITPKTKWFVFNSPSNPSGAAYSHEELK 187 YPEMV LCGG V ++ FKL LD AITP+T+W + NSPSNP+GA YS EEL+ Sbjct: 132 YPEMVQLCGGESRIVTCDADSGFKLTPAALDAAITPQTRWLILNSPSNPTGAVYSREELQ 191 Query: 188 ALTDVLMKHPHVWVLTDDMYEHLTYGDFRFATPVEVEPGLYERTLTMNGVSKAYAMTGWR 247 AL DVL+ HPHV +L DD+YEHL + D F T +VEP L RTLTMNGVSKAYAMTGWR Sbjct: 192 ALADVLLAHPHVLILADDIYEHLIFDDQVFYTLAQVEPRLASRTLTMNGVSKAYAMTGWR 251 Query: 248 IGYAAGPLHLIKAMDMIQGQQTSGAASIAQWAAVEALNGPQDFIGRNKEIFQGRRDLVVS 307 IG+A GP L++AM+ +QGQQTSGA+SI+Q AA+ AL+GP+DFI ++ +FQ RRDL+V+ Sbjct: 252 IGFATGPRWLLEAMEKLQGQQTSGASSISQQAALAALDGPKDFIRESRAVFQRRRDLMVA 311 Query: 308 MLNQAKGISCPTPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGVAVVHGSA 367 +LN G++C +P GAFY + SCAGLIG+T+ G+V+ TDED LL+ VAVVHGSA Sbjct: 312 LLNATPGLACASPGGAFYAFASCAGLIGRTSSGGRVLHTDEDVAHALLDEADVAVVHGSA 371 Query: 368 FGLGPNFRISYATSEALLEEACRRIQRFCAACR 400 FGLGP RI+YA +A L +AC I+ FC A R Sbjct: 372 FGLGPYIRIAYALDDASLRQACEAIRGFCDALR 404 Lambda K H 0.318 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 404 Length adjustment: 31 Effective length of query: 369 Effective length of database: 373 Effective search space: 137637 Effective search space used: 137637 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory