Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate Pf6N2E2_1339 Acetylornithine deacetylase (EC 3.5.1.16)
Query= ecocyc::ACETYLORNDEACET-MONOMER (383 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 Length = 394 Score = 195 bits (496), Expect = 2e-54 Identities = 133/381 (34%), Positives = 191/381 (50%), Gaps = 15/381 (3%) Query: 13 RALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRNKFNMLASIGQGA 72 RAL+A AT SN LI + D+ + LG N E+ R K N+LASIG Sbjct: 12 RALLAELVSFATVSR--DSNLALIEFVRDYLQGLGVNSELI-YNAERTKANLLASIGPAV 68 Query: 73 -GGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVTK 131 GG++L+GHTD VP D WT DPF LTE DGK +G GTADMKG+ A +L A+ + Sbjct: 69 PGGVVLSGHTDVVPVDGQAWTVDPFCLTEMDGKWFGRGTADMKGYLASVLAAVPVFLSSP 128 Query: 132 LKKPLYILATADEETSMAGARYFAETTALR---PDCAIIGEPTSLQPVRAHKGHISNAIR 188 L++P+++ + DEE G E R P +IGEPT L+PV HKG ++ Sbjct: 129 LRRPVHLAFSYDEEVGCLGVHSLLEVLVRRIAQPALCLIGEPTQLRPVLGHKGKLAMRCH 188 Query: 189 IQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKE-RYHYEAFTVPYPTLNLGHIHGG 247 ++G + HS+ GVNAIE IG + ++ L E H F T+ +G +HGG Sbjct: 189 VRGAACHSAYAPYGVNAIEQAARLIGRLGEIGAQLAEPSRHDPRFDPACSTVQVGVVHGG 248 Query: 248 DASNRICACCELHMDIRPLPG----MTLNELNGLLNDALAPVSERWPGRLTVD-ELHPPI 302 A N + A C ++R LP + + +L G L P + G + E Sbjct: 249 TALNIVPADCRFDFEVRALPDFDPLVVVEQLQGYAEQTLLPAMQAVAGDTAIRFEPLSAY 308 Query: 303 PGYECPPNHQLVEVVEKLLGAKT-EVVNYCTEAP-FIQTLCPTLVLGPGSINQAHQPDEY 360 PG P+ ++ +L G+ V + TE F Q PT+V GPGS++Q H+PDEY Sbjct: 309 PGLATSPDSAAARLIAQLCGSDAFGTVAFGTEGGLFHQAGVPTVVCGPGSMDQGHKPDEY 368 Query: 361 LETRFIKPTRELITQVIHHFC 381 + + L+ ++ + C Sbjct: 369 VSVEQMAACDRLMDRLASYLC 389 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 394 Length adjustment: 30 Effective length of query: 353 Effective length of database: 364 Effective search space: 128492 Effective search space used: 128492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Pf6N2E2_1339 (Acetylornithine deacetylase (EC 3.5.1.16))
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.6414.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-125 404.8 0.0 1.9e-125 404.6 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 Acetylornithine deacetylase (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 Acetylornithine deacetylase (EC 3.5.1.16) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 404.6 0.0 1.9e-125 1.9e-125 2 364 .. 14 384 .. 13 385 .. 0.96 Alignments for each domain: == domain 1 score: 404.6 bits; conditional E-value: 1.9e-125 TIGR01892 2 ilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvls 65 +la+Lv+f +vs+ sn++lie+v+dyl+ lgv+ e + +a+ +k nlla+iGp++ gg+vls lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 14 LLAELVSFATVSRDSNLALIEFVRDYLQGLGVNSELIYNAER-TKANLLASIGPAV-PGGVVLS 75 689*************************************99.************9.9****** PP TIGR01892 66 GhtDvvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsa 129 GhtDvvPvd++aWt Dpf Lte dg+ +grGtaDmkG+la vLaavp +L++P+hl++s+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 76 GHTDVVPVDGQAWTVDPFCLTEMDGKWFGRGTADMKGYLASVLAAVPVFLSSPLRRPVHLAFSY 139 **************************************************************** PP TIGR01892 130 DeevglaGakklieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGv 190 Deevg++G+++l+e+l +pal ++GePt+l++v hkGk +++ +vrG hs+++ Gv lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 140 DEEVGCLGVHSLLEVLVrriAQPALCLIGEPTQLRPVLGHKGKLAMRCHVRGAACHSAYAPYGV 203 ***************9977789****************************************** PP TIGR01892 191 saielaakllarlvaladklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpi 253 +aie+aa+l++rl + +l + + ++ F+p +t+++G+v+GG+a ni++a C++ +e+R++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 204 NAIEQAARLIGRLGEIGAQLAEpSRHDPRFDPACSTVQVGVVHGGTALNIVPADCRFDFEVRAL 267 *********************98999************************************** PP TIGR01892 254 pGmdpeellallekiaee.....vkekapgfevkveelsatpaleleedaelvalleklaGa.a 311 p dp + ++l+ ae+ +++ a ++ ++ e lsa+p+l++ +d+ +++l+++l G+ a lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 268 PDFDPLVVVEQLQGYAEQtllpaMQAVAGDTAIRFEPLSAYPGLATSPDSAAARLIAQLCGSdA 331 ********999999998877765555566677788999***********************989 PP TIGR01892 312 aevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrallerl 364 +v++gte gl+ ++G+++vv+GPG++dq h+pdeYv +e++ +c+ l+ rl lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 332 FGTVAFGTEGGLFHQAGVPTVVCGPGSMDQGHKPDEYVSVEQMAACDRLMDRL 384 9*************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.61 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory