Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate Pf6N2E2_2025 2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha (EC 2.5.1.54)
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 Length = 356 Score = 355 bits (911), Expect = e-102 Identities = 179/327 (54%), Positives = 226/327 (69%), Gaps = 4/327 (1%) Query: 22 QLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETALEYARRFKALA 81 QLK PLS Q++ R++I I+ G D RLLV+ GPCSIHDP++ALEYA +A Sbjct: 29 QLKHQLPLSTALSHQVSVHRQAIRAILNGEDARLLVIVGPCSIHDPKSALEYATNLARVA 88 Query: 82 AEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLELVNMGLPL 141 EVSDS+ LVMR Y EKPRTTVGWKGL DP +DGS D+ AGL ++R+L+ E++ +GLP+ Sbjct: 89 HEVSDSMLLVMRAYVEKPRTTVGWKGLAYDPGLDGSDDMAAGLTLSRELMREMLQLGLPV 148 Query: 142 ATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAM 201 ATE L P + Y DL SW AIGARTTESQ HREMASGL MPVGFKNGTDG + A +AM Sbjct: 149 ATELLQPMAASYFDDLLSWVAIGARTTESQIHREMASGLGMPVGFKNGTDGGVGIACDAM 208 Query: 202 RAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGG-KAPNYSPADVAQCEKEMEQAGLR 260 R+AA PHR G++ G A++QT GNPD H++LRGG + PNY V Q ++ + + Sbjct: 209 RSAAHPHRHFGVDSQGHPAIIQTPGNPDTHLVLRGGHRGPNYDQQSVTQIHHDLTRLKIP 268 Query: 261 PSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQPRSEM 320 +MVDCSH NS KD RQP V V+ Q GNR++IG+M+ES++ EG Q M Sbjct: 269 ARIMVDCSHANSGKDPLRQPQVFNDVLEQRLQGNRALIGMMLESHLFEGCQPL---GPSM 325 Query: 321 KYGVSVTDACISWEMTDALLREIHQDL 347 +YGVSVTD C+ WE T+ LLRE H+ L Sbjct: 326 RYGVSVTDGCLGWESTERLLREAHRKL 352 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 356 Length adjustment: 29 Effective length of query: 327 Effective length of database: 327 Effective search space: 106929 Effective search space used: 106929 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Pf6N2E2_2025 (2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha (EC 2.5.1.54))
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.12694.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-136 440.3 0.0 2.5e-136 439.9 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 2-keto-3-deoxy-D-arabino-heptulo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha ( # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 439.9 0.0 2.5e-136 2.5e-136 11 338 .. 24 352 .. 16 354 .. 0.98 Alignments for each domain: == domain 1 score: 439.9 bits; conditional E-value: 2.5e-136 TIGR00034 11 lltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkkl 74 l + +lk++ pl+++ ++v r++i il+G+d rllv++GPcsihdp++aleya+ l+++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 24 LPSSLQLKHQLPLSTALSHQVSVHRQAIRAILNGEDARLLVIVGPCSIHDPKSALEYATNLARV 87 55667899******************************************************** PP TIGR00034 75 aeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplate 138 a++++d++ +vmr+y+ekPrttvGWkGl dP l++s d+ +Gl ++r+l+ ++ +lglp+ate lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 88 AHEVSDSMLLVMRAYVEKPRTTVGWKGLAYDPGLDGSDDMAAGLTLSRELMREMLQLGLPVATE 151 **************************************************************** PP TIGR00034 139 lldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaeh 202 ll+++++ y+ dllsw aiGarttesq+hre+asgl +pvgfkngtdG++ +a da+r+aa++h lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 152 LLQPMAASYFDDLLSWVAIGARTTESQIHREMASGLGMPVGFKNGTDGGVGIACDAMRSAAHPH 215 **************************************************************** PP TIGR00034 203 lflsvtkaGqvaivetkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgn 265 + ++v+ +G+ ai++t Gn+d+h++lrGG++ pnyd+++v +++++l++++ +++m+d+sh+n lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 216 RHFGVDSQGHPAIIQTPGNPDTHLVLRGGHRgPNYDQQSVTQIHHDLTRLKIPARIMVDCSHAN 279 *******************************9******************************** PP TIGR00034 266 snkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqslkeelkyGksvtdacigwedtea 329 s kd rq++v ++v eq +G++a+iG+m+es+l eG q l+ ++ yG+svtd c+gwe+te+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 280 SGKDPLRQPQVFNDVLEQRLQGNRALIGMMLESHLFEGCQPLGPSMRYGVSVTDGCLGWESTER 343 **************************************************************** PP TIGR00034 330 llrklaeav 338 llr+ ++++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 344 LLREAHRKL 352 ***988765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.84 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory