Align Cysteine synthase; CSase; EC 2.5.1.47; O-acetylserine (thiol)-lyase; OAS-TL; O-acetylserine sulfhydrylase (uncharacterized)
to candidate Pf6N2E2_1562 Threonine dehydratase (EC 4.3.1.19)
Query= curated2:Q59447 (307 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1562 Length = 318 Score = 61.2 bits (147), Expect = 3e-14 Identities = 53/165 (32%), Positives = 75/165 (45%), Gaps = 18/165 (10%) Query: 28 IWIKLEKSNPGGSIKDRIALAMI-----EDAEAKGLLNKDSTIIEPTSGNTGIGLALVAA 82 +W+K E P G+ K R L + E EAKG I+ T GN G LAL A+ Sbjct: 39 VWVKHENHTPTGAFKVRGGLTFVRWLKREHPEAKG-------IVTATRGNHGQSLALAAS 91 Query: 83 VKGYKLILVMPESMSIERRKIMEAYGAEFVLTPREKGMKGAIEKANELAEETPNSWIPRQ 142 G K ++V+P+ S+E+ M +G E V R+ A E+A LA+ +P Sbjct: 92 ALGLKALIVVPQGNSVEKNNAMRGFGGEVVEYGRD--FDEAREEAVRLAQSHGLYLVPP- 148 Query: 143 FDNPANVKIHVETTAQEILQDFPEGLDYVITGVGTGGHITGIAKA 187 +P VK V T E+ P+ LD V +G G I + A Sbjct: 149 -FHPELVK-GVATYGLELFNAVPD-LDTVYVPIGCGSGICAVIAA 190 Lambda K H 0.315 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 318 Length adjustment: 27 Effective length of query: 280 Effective length of database: 291 Effective search space: 81480 Effective search space used: 81480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory